DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and KCO5

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:200 Identity:42/200 - (21%)
Similarity:77/200 - (38%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SSSYTSTSSTTSSNSSSSEYTRSSRQSSSLV-----------DIQYTESDSD------------- 271
            |||.:|.|.|...:.|::.:.....|...|:           |.:..:||||             
plant    21 SSSSSSASITIPRSISNTSFFHEISQERLLLHHQDLEQSVQDDKEDQDSDSDETNRFLSQTRPLH 85

  Fly   272 ---------IEREIRGSTDEITVPVTV-------CVFVMVGYILWGALLFGRWEDWNY------- 313
                     |.:::|....|...|..|       .:|:::.|:..|..::....| :|       
plant    86 RSRTAPAMVIIKDLRTKPPETKKPSPVSKSIIRQAIFLLIVYLTLGVSIYSFNRD-HYSGIETHP 149

  Fly   314 -LDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLL--LGMAVIAMCFNLMQEQV 375
             :|..|||::::.:||:||:.|    :|.......|.|:|.....|  |...|:....:|.:..:
plant   150 VVDALYFCIVTMCTIGYGDIAP----LTPWTKIFAVVFVLFGFGFLDILLSGVVNYVLDLQESMI 210

  Fly   376 VHNIR 380
            :..|:
plant   211 LTGIQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168
Ion_trans_2 292..377 CDD:285168 22/94 (23%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 21/86 (24%)
Ion_trans_2 254..325 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.