Sequence 1: | NP_610349.1 | Gene: | sand / 35777 | FlyBaseID: | FBgn0033257 | Length: | 395 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_192093.1 | Gene: | KCO5 / 828091 | AraportID: | AT4G01840 | Length: | 408 | Species: | Arabidopsis thaliana |
Alignment Length: | 200 | Identity: | 42/200 - (21%) |
---|---|---|---|
Similarity: | 77/200 - (38%) | Gaps: | 55/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 SSSYTSTSSTTSSNSSSSEYTRSSRQSSSLV-----------DIQYTESDSD------------- 271
Fly 272 ---------IEREIRGSTDEITVPVTV-------CVFVMVGYILWGALLFGRWEDWNY------- 313
Fly 314 -LDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLL--LGMAVIAMCFNLMQEQV 375
Fly 376 VHNIR 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sand | NP_610349.1 | Ion_trans_2 | 123..183 | CDD:285168 | |
Ion_trans_2 | 292..377 | CDD:285168 | 22/94 (23%) | ||
KCO5 | NP_192093.1 | Ion_trans_2 | 122..204 | CDD:285168 | 21/86 (24%) |
Ion_trans_2 | 254..325 | CDD:285168 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I4317 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D774951at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |