DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk16

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_083282.1 Gene:Kcnk16 / 74571 MGIID:1921821 Length:292 Species:Mus musculus


Alignment Length:349 Identity:80/349 - (22%)
Similarity:137/349 - (39%) Gaps:126/349 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIGGAFIFQSIE---------IFEYERLKSEKPHRFIARNFSGECLSRIWELTAENI 91
            ::|....|::.||.|||.:|         .|:.|:|      ||:                 ||.
Mouse    17 LLLAYICYLLLGATIFQLLEKQAEAQSRDQFQLEKL------RFL-----------------ENY 58

  Fly    92 SFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGK 156
            :..|..|..:.|..:|..:.:.:..|. ...:...|.|..:|.::.||:|||||||:.|.:|.|:
Mouse    59 TCLDQQALEQFVQVILEAWVKGVNPKG-NSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQ 122

  Fly   157 LVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQ 221
            :..:.||::|:||.:::|:::|..|                            |..:..|.|   
Mouse   123 VFCVFYALMGIPLNVVFLNHLGTGL----------------------------RAHLTTLDR--- 156

  Fly   222 MHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVP 286
                                        :....|.|..|              ::.|        
Mouse   157 ----------------------------WEDHPRHSQLL--------------QVLG-------- 171

  Fly   287 VTVCVFVMVG---YILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDK--V 346
              :.:|:.:|   .:::..:.|...|.|::.:|.||..|:||:|||||.|.|     .|..|  :
Mouse   172 --LALFLTLGTLVILIFPPMFFSHVEGWSFREGFYFAFITLSTIGFGDYVVG-----TDPSKHYI 229

  Fly   347 EVSFILCAIYLLLGMAVIAMCFNL 370
            .|...|.||::|||:|.:|:..:|
Mouse   230 AVYRSLAAIWILLGLAWLAVVLSL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 23/59 (39%)
Ion_trans_2 292..377 CDD:285168 30/84 (36%)
Kcnk16NP_083282.1 Ion_trans_2 <92..148 CDD:285168 23/83 (28%)
Ion_trans_2 180..248 CDD:285168 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9871
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.