DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and CG42340

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster


Alignment Length:409 Identity:104/409 - (25%)
Similarity:185/409 - (45%) Gaps:97/409 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYE-------RLKSEKPH---RFIARN 74
            |.||       .|..|::|||..|...|:.:|.::| .|.|       .:.:.||:   ......
  Fly    90 KSHC-------ISATGVLLLVLLYTAMGSIVFVTLE-GELEDGGALETAVAASKPYPRTELANAE 146

  Fly    75 FSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKK------------QLKGPDVEQW 127
            .....:.|:|.:|.:....:..:..|....:|.| :|..:::.            ||..| ..:|
  Fly   147 IRSRTVDRLWSITEDLNILYKENWTRLAAQEVQL-FQDTLLRAVRQSKVYPPGGIQLNAP-THKW 209

  Fly   128 SFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKV 192
            :::.|||||||:|||||||.|:|.::.|::..::||:.|:|:.|||||.:|:.|:...:      
  Fly   210 TYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMR------ 268

  Fly   193 CLCR---------------ICPGVAK--------RRIIRER-------RKMRQLARALQMHDMEN 227
            ||.|               ...||..        |:..:.:       :|:.|......::..:.
  Fly   269 CLFRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQ 333

  Fly   228 ARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVF 292
            |:.:.......:..:..:...:..:..:.|.:.                |||.   :||:::||.
  Fly   334 AQQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNR----------------RGSP---SVPISICVC 379

  Fly   293 VMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYL 357
            |::.|:..||:||.:.::|:.|:..|||..||.:||||::.|..          .|:....:.|:
  Fly   380 VLLCYVSSGAILFHKLQNWSVLESLYFCFTSLGTIGFGEMAPNG----------AVALYTASAYI 434

  Fly   358 LLGMAVIAMCFNLMQEQVV 376
            |:||||:||||:|:|.::|
  Fly   435 LVGMAVVAMCFSLIQTEIV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 29/59 (49%)
Ion_trans_2 292..377 CDD:285168 32/85 (38%)
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 28/55 (51%)
Ion_trans_2 380..453 CDD:400301 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461309
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.