DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk16

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001102990.1 Gene:Kcnk16 / 688996 RGDID:1582911 Length:292 Species:Rattus norvegicus


Alignment Length:349 Identity:80/349 - (22%)
Similarity:137/349 - (39%) Gaps:126/349 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIGGAFIFQSIE---------IFEYERLKSEKPHRFIARNFSGECLSRIWELTAENI 91
            ::|....|::.||.|||.:|         .|:.|:|      ||:                 ||.
  Rat    17 LLLAYICYLLLGATIFQRLEKQAEAQSRDQFQLEKL------RFL-----------------ENY 58

  Fly    92 SFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGK 156
            :..|..|..:.|..:|..:.:.:..|. ...:...|.|..:|.::.||:|||||||:.|.:|.|:
  Rat    59 TCLDQQALEQFVQVILEAWVKGVNPKG-NSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQ 122

  Fly   157 LVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQ 221
            :..:.||::|:||.:::|:::|..|                            |..:..|.|   
  Rat   123 VFCVFYALMGIPLNVVFLNHLGTGL----------------------------RAHLTTLDR--- 156

  Fly   222 MHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVP 286
                                        :....|.|..|              ::.|        
  Rat   157 ----------------------------WEDHPRHSQLL--------------QVLG-------- 171

  Fly   287 VTVCVFVMVG---YILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDK--V 346
              :.:|:.:|   .:::..:.|...|.|::.:|.||..|:||:|||||.|.|     .|..|  :
  Rat   172 --LALFLTLGTLVILIFPPMFFSHVEGWSFREGFYFAFITLSTIGFGDYVVG-----TDPSKHYI 229

  Fly   347 EVSFILCAIYLLLGMAVIAMCFNL 370
            .|...|.||::|||:|.:|:..:|
  Rat   230 AVYRSLAAIWILLGLAWLAVVLSL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 23/59 (39%)
Ion_trans_2 292..377 CDD:285168 30/84 (36%)
Kcnk16NP_001102990.1 Ion_trans_2 <92..148 CDD:285168 23/83 (28%)
Ion_trans_2 180..248 CDD:285168 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9664
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.