DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk5a

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001032478.1 Gene:kcnk5a / 570159 ZFINID:ZDB-GENE-051113-112 Length:513 Species:Danio rerio


Alignment Length:378 Identity:87/378 - (23%)
Similarity:128/378 - (33%) Gaps:164/378 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVN 104
            :.||:..||.|||.|          |:|:               ||:....        ||....
Zfish    12 IIFYLSIGAAIFQVI----------EEPN---------------WEIAVRK--------YRADKE 43

  Fly   105 DVL----------LDYQRAIVKKQLKGPDV--------EQWSFSGAFLYSLTVITTIGYGNITPH 151
            .:|          |||...:| ....|..:        ..|::..|.:::.|||||||||||.|.
Zfish    44 SILKQYPCLTKADLDYILEVV-SDAAGQGITITGDKTFNNWNWPNAVIFAATVITTIGYGNIAPK 107

  Fly   152 SECGKLVTILYAIIGMPLFLLYLSNIGDVL---AKSFKWIYSKVCLCRICPGVAKRRIIRERRKM 213
            :..|::..|.|.:.|:||...::|.:|...   ||...|..:|       .||..|:        
Zfish   108 TPSGRVFCIFYGLFGVPLCFTWISELGKFFGGRAKHLGWYLTK-------KGVTLRK-------- 157

  Fly   214 RQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRG 278
            .||                                                              
Zfish   158 TQL-------------------------------------------------------------- 160

  Fly   279 STDEITVPVTVCVFVMVGYILWGALL--------FGRWEDWNYLDGSYFCLISLSSIGFGDLV-- 333
                      .|..|   ::|||.|:        |...|.|.|::|.||..::|::|||||||  
Zfish   161 ----------TCTAV---FLLWGVLIHLVIPPFVFMTQEGWTYIEGLYFSFVTLTTIGFGDLVAG 212

  Fly   334 --PGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKR 384
              |.....|..|..|||       ::.||:|.:::.||.....||...:|:|:
Zfish   213 VDPNAEYPTLYRYFVEV-------WIYLGLAWLSLFFNWKVRMVVEAHKALKK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 22/70 (31%)
Ion_trans_2 292..377 CDD:285168 32/96 (33%)
kcnk5aNP_001032478.1 Ion_trans_2 <81..137 CDD:285168 22/55 (40%)
Ion_trans_2 171..243 CDD:285168 25/78 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.