DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk10a

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001305304.1 Gene:kcnk10a / 563228 ZFINID:ZDB-GENE-041210-291 Length:569 Species:Danio rerio


Alignment Length:391 Identity:85/391 - (21%)
Similarity:144/391 - (36%) Gaps:146/391 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHA 98
            :.:.::|..|::.|..:|:::| ..:||.:.:                   .:|.:..:|...|.
Zfish    90 LAVFVVVVAYLVAGGLVFRALE-QHFERYQKD-------------------SITLKKAAFLLKHP 134

  Fly    99 YRRRVNDVLLDYQRAIVKKQLKGPDV------------EQWSFSGAFLYSLTVITTIGYGNITPH 151
            .      |..|....::|..:...:.            ..|....:|.::.|||||||||||.|.
Zfish   135 C------VTPDELEELIKHSVDAVNAGVSPIGDTSYNSSHWDLGSSFFFAGTVITTIGYGNIAPS 193

  Fly   152 SECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQL 216
            :|.||:..|||||.|:|||...|:.:||.|...|....:||           .::.  |||..|:
Zfish   194 TEGGKIFCILYAIFGIPLFGFLLAGVGDQLGTIFGKSIAKV-----------EKMF--RRKHNQI 245

  Fly   217 ARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTD 281
                                                                          |..
Zfish   246 --------------------------------------------------------------SQT 248

  Fly   282 EITVPVTVCVFVMVGYILW---GALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADR 343
            :|.|..|: :|::.|.||:   .|::|...|.|..|:..||.:|:|:::|.||.|.|      ..
Zfish   249 KIRVASTL-LFILAGCILFVTIPAIIFKHIEGWTGLEAIYFVVITLTTVGIGDYVAG------GN 306

  Fly   344 DKVE--------VSFILCAIYLLLGMAVIAMCFNLMQEQV----------VHNIRAIKRGFKACF 390
            .::|        |.|     ::|:|:|..|...:::.:.:          |..|:|....:||..
Zfish   307 RRIEYRKWYRPLVWF-----WILVGLAYFAAVLSMIGDWLRVLSKKTKMEVGEIKAHAAEWKANV 366

  Fly   391 R 391
            |
Zfish   367 R 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 30/71 (42%)
Ion_trans_2 292..377 CDD:285168 25/105 (24%)
kcnk10aNP_001305304.1 Ion_trans_2 164..223 CDD:285168 29/58 (50%)
Ion_trans_2 263..342 CDD:285168 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.