DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk1b

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001277277.1 Gene:kcnk1b / 561206 ZFINID:ZDB-GENE-090312-78 Length:337 Species:Danio rerio


Alignment Length:376 Identity:84/376 - (22%)
Similarity:141/376 - (37%) Gaps:136/376 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FMFSNVGIILLVTFYIIGGAFIFQSIE------------------IFEYERLKSEKPHRFIARNF 75
            |:|..:|.:|    |:|.||.:|.|:|                  :.|::.|..|:..||     
Zfish    23 FLFLVLGYVL----YLIFGAVVFSSVELPYEDDLRQQLREIKRLFLQEHQCLSEERLERF----- 78

  Fly    76 SGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVI 140
                ||:..|.:...:|.         :|:....:               .|.|:.:..::.||:
Zfish    79 ----LSKALEASNYGVSI---------LNNASASW---------------NWDFTSSLFFASTVL 115

  Fly   141 TTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRR 205
            :|.|||:..|.|:.||...|:|::||:|..||:|:.:...:.....|                |.
Zfish   116 STTGYGHTAPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRIMVYSTW----------------RP 164

  Fly   206 IIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDS 270
            |:                          |.              :||.. .|..||.:.:.    
Zfish   165 IM--------------------------YV--------------HTRWG-LSKPLVALVHA---- 184

  Fly   271 DIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPG 335
                       .:...|.|..|.::...::.||    .|:||:|:..|||.||||:||.||.|||
Zfish   185 -----------TLLAVVAVSCFFLIPAAIFSAL----EENWNFLESFYFCFISLSTIGLGDYVPG 234

  Fly   336 DRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKRGF 386
            :......|:..::..   .:|||||:  |||...|.....:..::.:::.|
Zfish   235 EAFNQRFRELYKLGI---TVYLLLGL--IAMLVVLETFCELQQLKQLRKMF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 20/59 (34%)
Ion_trans_2 292..377 CDD:285168 31/84 (37%)
kcnk1bNP_001277277.1 Ion_trans_2 <99..157 CDD:285168 20/72 (28%)
Ion_trans_2 192..267 CDD:285168 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10296
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.