DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001028697.2 Gene:Kcnk6 / 52150 MGIID:1891291 Length:313 Species:Mus musculus


Alignment Length:267 Identity:62/267 - (23%)
Similarity:99/267 - (37%) Gaps:103/267 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 WSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLA--------- 182
            |.|:.|..::.|::||:|||..||.::.||..:|::|::|:|:.:|.|:.....|:         
Mouse    91 WDFASALFFASTLVTTVGYGYTTPLTDAGKAFSIVFALLGVPITMLLLTASAQRLSLLLTHAPLS 155

  Fly   183 -KSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSS 246
             .|..|.:..                         .||.:.|                       
Mouse   156 WLSLHWGWPP-------------------------QRAARWH----------------------- 172

  Fly   247 SSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWED- 310
                         ||.:                     :.|.|.:|.:|     .|.:|...|: 
Mouse   173 -------------LVAL---------------------LMVIVAIFFLV-----PAAVFAYLEEA 198

  Fly   311 WNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQV 375
            |::||..|||.||||:||.||.|||:......|...:|   |...||.||:  :||...|...:.
Mouse   199 WSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKV---LVTAYLFLGL--VAMVLVLQTFRR 258

  Fly   376 VHNIRAI 382
            |.::..:
Mouse   259 VSDLHGL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 20/65 (31%)
Ion_trans_2 292..377 CDD:285168 32/85 (38%)
Kcnk6NP_001028697.2 Ion_trans_2 <91..146 CDD:285168 19/54 (35%)
Ion_trans <171..253 CDD:278921 36/148 (24%)
Ion_trans_2 180..259 CDD:285168 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10523
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.