DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:351 Identity:84/351 - (23%)
Similarity:139/351 - (39%) Gaps:119/351 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TAF--MFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAE 89
            |||  .|..:|.||....|::.||.:|.:||....|.||::                 :..|.||
Zfish     3 TAFRSCFMLIGFILAYFTYLLLGALVFSAIERPIEESLKAD-----------------LSSLKAE 50

  Fly    90 --NISFFDHHAYRRRVNDVLLD-YQRAIVKKQLKGPDV-------EQWSFSGAFLYSLTVITTIG 144
              |:|.         ||...|: :...::|....|..|       ..|..:.:..::.|::||:|
Zfish    51 FLNLSC---------VNSTALETFLERVLKANKYGVSVLENASLRTNWDLASSLFFANTMVTTVG 106

  Fly   145 YGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRE 209
            ||:.||.|:.||..:|:||:||:|..:|.|:                .|:.|:            
Zfish   107 YGHTTPLSDAGKAFSIVYALIGVPFTMLVLT----------------ACVQRL------------ 143

  Fly   210 RRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIER 274
                        ||.:              |....|:........::|:|:|....         
Zfish   144 ------------MHPL--------------TYRPISACQRRAGLQQRSASVVHFIV--------- 173

  Fly   275 EIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWED-WNYLDGSYFCLISLSSIGFGDLVPGDRV 338
                    :...|.:|.||:      .:|:|...|: |::||..|||.|||.:||.||.||.::.
Zfish   174 --------LLFLVVLCFFVV------PSLVFSAIEETWSFLDAFYFCFISLCTIGLGDFVPAEKP 224

  Fly   339 ITADRDKVEVSFILCAIYLLLGMAVI 364
            ..:.|...::|.:   :||.:|:.|:
Zfish   225 GQSLRALYKISVM---VYLFVGLMVM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 21/66 (32%)
Ion_trans_2 292..377 CDD:285168 26/74 (35%)
kcnk6NP_001025245.2 Ion_trans_2 84..145 CDD:285168 22/100 (22%)
Ion_trans_2 178..254 CDD:285168 28/79 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10296
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.