DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk7

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002728904.1 Gene:Kcnk7 / 499303 RGDID:1565025 Length:316 Species:Rattus norvegicus


Alignment Length:371 Identity:83/371 - (22%)
Similarity:130/371 - (35%) Gaps:133/371 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILLVTFYIIG---GAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISF-FDHH 97
            :|||..:::.   ||.:.|::|                    ....|....:|.||..:| .:|.
  Rat    11 LLLVMAHLLAMGLGAVVLQALE--------------------GPPALHLQVQLQAELAAFQAEHR 55

  Fly    98 A-----YRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKL 157
            |     ....:...:|..|...|.....|.:...|....|.|::.:::||.|||.:.|.|..||.
  Rat    56 ACLPPEALEELLGAVLTAQAHGVSSLGNGSETSNWDLPSALLFTASILTTTGYGRMAPFSSGGKA 120

  Fly   158 VTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPG--VAKRRIIRERRKMRQLARAL 220
            ..::||.:|:|..|..::.:...|...|.           |||  ||.|         .|||.| 
  Rat   121 FCVVYAALGLPASLALVAALRRCLLPVFS-----------CPGAWVAAR---------WQLAPA- 164

  Fly   221 QMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITV 285
                                          ..:..|::.|                 |.      
  Rat   165 ------------------------------QAALLQAAGL-----------------GL------ 176

  Fly   286 PVTVCVFVMV-GYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGD---------RVIT 340
             :..|||::: ..:|||  :.|   |.:.|:..|||..|||:||.|||:|..         |:  
  Rat   177 -LVACVFMLLPALVLWG--IQG---DCSLLEAIYFCFGSLSTIGLGDLLPAQGRGLHPAIYRL-- 233

  Fly   341 ADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKRGF 386
                   ..|.|.. |||||:..:.:......|  :..:||:.:.|
  Rat   234 -------GQFALLG-YLLLGLLAMLLAVETFSE--LPQVRAVVKFF 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 18/59 (31%)
Ion_trans_2 292..377 CDD:285168 28/94 (30%)
Kcnk7XP_002728904.1 Ion_trans_2 <88..144 CDD:400301 17/55 (31%)
Ion_trans_2 178..>225 CDD:400301 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.