DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Task6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster


Alignment Length:342 Identity:90/342 - (26%)
Similarity:142/342 - (41%) Gaps:107/342 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NVGIILLV--TF-YIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFF 94
            ||..|.|:  || |::.||.:|.::|      .::|| .|:.|...:.:.:.|.:.::.|:....
  Fly     5 NVRTISLIVCTFTYLLVGAAVFDALE------SETEK-RRWEALQDAEDMIIRKYNISQEDFKVM 62

  Fly    95 DHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVT 159
            :                 .:|.|.......:||.|:|||.|:.||:||||||:.||.:..|||.|
  Fly    63 E-----------------TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFT 110

  Fly   160 ILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHD 224
            :.|||:|:||.|:...:||:                                             
  Fly   111 MCYAIVGIPLGLVMFQSIGE--------------------------------------------- 130

  Fly   225 MENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTV 289
                                       |.:|.||.:  |:...|....:|.:....|.|.|..|:
  Fly   131 ---------------------------RVNRLSSYV--IKAVRSSLRCKRTVASEVDLICVVTTL 166

  Fly   290 CVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCA 354
            ....:.|    ||..|.::|.|:|.|..|:|.|:|::|||||:|...|....:|....|.|.|  
  Fly   167 SSLTIAG----GAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFAL-- 225

  Fly   355 IYLLLGMAVIAMCFNLM 371
            |::|.|:|::|...||:
  Fly   226 IFILFGLAIVAASLNLL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 30/59 (51%)
Ion_trans_2 292..377 CDD:285168 30/80 (38%)
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 30/126 (24%)
Ion_trans_2 169..247 CDD:285168 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461299
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.