DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Task7

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:349 Identity:93/349 - (26%)
Similarity:142/349 - (40%) Gaps:121/349 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NVGIILLV--TF-YIIGGAFIFQSI----EIFEYERLKSEKPHRFIARNFSGECLSRIWELTAEN 90
            ||..:.||  || |::.||.:|.|:    |...:|.|::.|      .||     .|.:.:|.|:
  Fly     6 NVRTLSLVVCTFTYLLIGAAVFDSLESPTEAKRWEFLQTVK------NNF-----VRKYNVTDED 59

  Fly    91 ISFFDHHAYRRRVNDVLLDYQRAIVKKQLK-GPDVEQWSFSGAFLYSLTVITTIGYGNITPHSEC 154
            .          ||.::::     |..|..| ||   ||.|:|||.:|..|:..||||:.||.:..
  Fly    60 F----------RVMEIVI-----IENKPHKAGP---QWKFAGAFYFSTVVLAMIGYGHSTPVTIP 106

  Fly   155 GKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARA 219
            ||...:.||::|:||.|:...:||:.|.|     ::.|             ||| |.|....||.
  Fly   107 GKAFCMGYAMVGIPLGLVMFQSIGERLNK-----FASV-------------IIR-RAKRASGARC 152

  Fly   220 LQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEIT 284
            ....:|.....:...:|...||                                           
  Fly   153 TDATEMNLMLATGMLSSIIITT------------------------------------------- 174

  Fly   285 VPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLV--PGDRVITADRDKVE 347
                            ||.:|.|:|.|:|.|..|:|.::|::|||||.|  ..|:.:|.....|.
  Fly   175 ----------------GAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVA 223

  Fly   348 VSFILCAIYLLLGMAVIAMCFNLM 371
            :|.    :::|.|:||:|...||:
  Fly   224 LSL----VFILFGLAVVAASINLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 25/59 (42%)
Ion_trans_2 292..377 CDD:285168 28/82 (34%)
Task7NP_649891.1 Ion_trans_2 <78..133 CDD:285168 24/54 (44%)
Ion_trans_2 166..248 CDD:285168 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.