DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk5b

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:378 Identity:82/378 - (21%)
Similarity:143/378 - (37%) Gaps:152/378 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GIIL--LVTFYIIGGAFIFQSIE-------IFEYERLKSE--KPHRFIARNFSGECLSRIWELTA 88
            |.||  ::.||:..||.|||.:|       :.:|:...:.  |.:..:::...||.:..:.|.|.
Zfish     5 GPILTSVIIFYLSIGAAIFQILEEPNLNSAVDDYKNKTNNLLKKYPCLSKEVLGEIIEVVAEATG 69

  Fly    89 ENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSE 153
            :.::                      |.|:.:   ...|::..|.:::.||||||||||:.|.:.
Zfish    70 QGVT----------------------VTKEAQ---FNNWNWENAVIFAATVITTIGYGNVAPKTT 109

  Fly   154 CGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLAR 218
            .|:|..|||.:.|:||.|.::|.:|.....                            :.::|::
Zfish   110 GGRLFCILYGLCGIPLCLTWISELGTFFGS----------------------------RTKRLSQ 146

  Fly   219 ALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEI 283
            .| :|...|.|                                .:|:                  
Zfish   147 LL-LHSGLNVR--------------------------------KVQF------------------ 160

  Fly   284 TVPVTVCVFVMVGYILWG--------ALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVIT 340
                 :|..|   ::|||        |.:|..:|:|.||:|.||...:|:::||||.|.|     
Zfish   161 -----ICTIV---FLLWGFLVHLIIPAFVFMFFENWTYLEGLYFSFTTLTTVGFGDYVAG----- 212

  Fly   341 ADRDKVEVS---------FILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKR 384
                 |:.|         |:...||  ||:|.:::.|:.....||...:.:|:
Zfish   213 -----VDPSVNYPTLYRFFVQLWIY--LGLAWLSLFFSWNVHMVVEAHKVLKK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 24/59 (41%)
Ion_trans_2 292..377 CDD:285168 30/101 (30%)
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 24/55 (44%)
Ion_trans <142..234 CDD:278921 32/162 (20%)
Ion_trans_2 171..243 CDD:285168 24/83 (29%)
C_Hendra 258..>323 CDD:293426 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.