DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-10

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001300134.1 Gene:twk-10 / 192080 WormBaseID:WBGene00006665 Length:429 Species:Caenorhabditis elegans


Alignment Length:395 Identity:77/395 - (19%)
Similarity:141/395 - (35%) Gaps:132/395 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRSSFRRREKPAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKS---- 64
            :||.|.|            .||.|.....:||:|||...|:..||..|...|..|.:|:..    
 Worm    22 KRSVFWR------------LRHLTRQGGLHVGLILLCILYVHFGALFFMYSESPEEQRILRRVEK 74

  Fly    65 ----------EKPHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQL 119
                      |..:|....:||.|  .|:.|..:..|..:..|.::...|.|..:....:...|.
 Worm    75 RYDILRETFLENVNRVKLEDFSDE--RRVNESISRLIDDYSKHMFKLFTNPVAANMFDCLFYSQS 137

  Fly   120 KGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKS 184
            ....:  |:...:.|::.|.|..:|||.|.|.:..|::|..:||..|:||.|:.:|::|...|.:
 Worm   138 NYTPL--WTTDSSLLFTATTIIPVGYGYIAPLTSTGRIVLCIYAAFGIPLALVMMSDVGKFFADA 200

  Fly   185 FKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSE 249
            |                                                                
 Worm   201 F---------------------------------------------------------------- 201

  Fly   250 YTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYL 314
                                      ::...:.||..:.|.:.::|.|.:.|.:.:.:......:
 Worm   202 --------------------------VKFFHENITAFMVVLLILLVAYSVIGGIAYSKIVGVPMI 240

  Fly   315 DGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNI 379
            :|.||..|::.:|||||:.||          :.|..|:  |:::.|:|::.:..:::...::|:|
 Worm   241 EGVYFSTITIFTIGFGDITPG----------IPVYVII--IFIVFGVAIVTIAIDVVAANIIHHI 293

  Fly   380 RAIKR 384
            ..:.|
 Worm   294 HYMGR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 19/59 (32%)
Ion_trans_2 292..377 CDD:285168 19/84 (23%)
twk-10NP_001300134.1 Ion_trans_2 <143..199 CDD:285168 19/55 (35%)
Ion_trans_2 218..291 CDD:285168 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.