DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-23

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001257229.1 Gene:twk-23 / 192071 WormBaseID:WBGene00006676 Length:443 Species:Caenorhabditis elegans


Alignment Length:395 Identity:86/395 - (21%)
Similarity:163/395 - (41%) Gaps:115/395 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSSFRRREKPAFERFKDHCR----HFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKSE 65
            |:|.....|.|:.:|::..|    |...:.|        |..|:..||::|..:| .|.|....:
 Worm    21 RTSTVSNSKCAWMKFRNVLRIALGHLALYCF--------VVCYVFAGAWVFHQLE-GENETELHD 76

  Fly    66 KPHRFIARNFSGECLSRIWELTAENISFFDHH--AYRRRVNDVLLDYQRAIVKKQLKGPDVEQWS 128
            |...: |.|...:.::::  .|.||::..:.|  .:.|.::::.:.....::..:......::|:
 Worm    77 KQREY-AMNLKKDVIAKL--ATTENVAEINEHLRMFLRNISNLHISLDNYLIFNEPTQIVPKRWT 138

  Fly   129 FSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVC 193
            |..:.|:|.|::|||||||:|||::..|:..::|...|:||||:.::::|.         :||..
 Worm   139 FPSSVLFSFTILTTIGYGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGR---------FSKTA 194

  Fly   194 LCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSS 258
            :..:...|:||.:.:                                                  
 Worm   195 IMALVQKVSKRELKK-------------------------------------------------- 209

  Fly   259 SLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWED-WNYLDGSYFCLI 322
                    :||..:.|||        ..|.:...:.|.:|..|:.:...||: ..|.|..||..:
 Worm   210 --------QSDEHLLREI--------AEVLLVAGLFVVFIAIGSAVIPLWENQLTYFDSVYFSYM 258

  Fly   323 SLSSIGFGDLVPGDRVITADRDKVEVSFIL-CAIYLLLGMAV-------IAMCFNLMQ--EQVVH 377
            ||::||.||:||.           .:.|:| ..||:.:|:.:       :|..|.|:.  .:.|.
 Worm   259 SLTTIGLGDIVPR-----------RMDFLLPTLIYITIGLWLTTALVEQLADVFRLVHYAGRQVT 312

  Fly   378 NIRAI 382
            |::.|
 Worm   313 NVKGI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 23/59 (39%)
Ion_trans_2 292..377 CDD:285168 25/95 (26%)
twk-23NP_001257229.1 Ion_trans_2 118..190 CDD:285168 23/80 (29%)
Ion_trans_2 228..302 CDD:285168 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.