DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_497973.1 Gene:twk-6 / 192070 WormBaseID:WBGene00006661 Length:347 Species:Caenorhabditis elegans


Alignment Length:258 Identity:54/258 - (20%)
Similarity:102/258 - (39%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVC 193
            |..|..:|.|:.:|:|||::.|||..|:.:||.|:::.:|:|:.:....|..||           
 Worm   109 FGKAIFFSWTLYSTVGYGSLYPHSTLGRYLTIFYSLLMIPVFIAFKFEFGTFLA----------- 162

  Fly   194 LCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSS 258
              .....|:.|..:..::...:|::     :.|||.           |.|||...:|        
 Worm   163 --HFLVVVSNRTRLAVKKAYYKLSQ-----NPENAE-----------TPSNSLQHDY-------- 201

  Fly   259 SLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLIS 323
             |:.:.                     .:.:|..    .:|..:.||...|:.:||...||.:|:
 Worm   202 -LIFLS---------------------SLLLCSI----SLLSSSALFSSIENISYLSSVYFGIIT 240

  Fly   324 LSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLL---LGMAVIAMC-------FNLMQEQVV 376
            :..||.||:||.:.|..:.         .|.::|:   |...:...|       |:::..:::
 Worm   241 MFLIGIGDIVPTNLVWFSG---------YCMLFLISDVLSNQIFYFCQARVRYFFHILARKIL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 19/53 (36%)
Ion_trans_2 292..377 CDD:285168 21/95 (22%)
twk-6NP_497973.1 Ion_trans_2 <109..163 CDD:285168 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.