DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-45

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001122742.2 Gene:twk-45 / 190614 WormBaseID:WBGene00006695 Length:508 Species:Caenorhabditis elegans


Alignment Length:422 Identity:99/422 - (23%)
Similarity:164/422 - (38%) Gaps:142/422 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RREK-------PAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEI-FEYERLKSE- 65
            ||||       .|:...|...||.|        :|.::..||..|.|:||.:|. .|.|.|:.. 
 Worm    64 RREKITWFFAWLAYYHHKFGIRHIT--------LISILAAYICLGGFLFQKLESPREIEELQETL 120

  Fly    66 KPHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLK---------- 120
            |....|.:|.:.:.:........|:        ..:::.|:|..|.|.:::.:.|          
 Worm   121 KSMNEIIKNETMDIIKITLTTNGED--------RNQKLGDLLRAYHRILLETEGKFHGSAWHKSE 177

  Fly   121 GPDVE-QWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKS 184
            ..|:. .|.||.|..||:|:.:|||||.||..:..||.|:::||.||:|:.||.|.:||....|.
 Worm   178 NLDMNLMWYFSSATFYSMTLFSTIGYGTITCQTFWGKTVSMVYASIGLPIMLLVLGDIGVWFQKV 242

  Fly   185 FKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSE 249
            ....|..|.|                                                      :
 Worm   243 MTNAYIFVML------------------------------------------------------K 253

  Fly   250 YTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWED---- 310
            |....:||            .:|:|:      |..:|:.:.:.|:..||:...|....::|    
 Worm   254 YKSLRKQS------------IEIKRK------ETLLPMWLAMLVVFTYIIICTLTILLFDDNEGD 300

  Fly   311 ---WNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMC----- 367
               .|:.|..||..|||::||.||::|.:         ::.|..| .:..|||:|:|::.     
 Worm   301 EPGINFFDAFYFTFISLTTIGLGDVMPYN---------IQYSPFL-PLAFLLGLALISIVNTSIY 355

  Fly   368 -------FNL---MQEQV--VHNIRAIKRGFK 387
                   :||   :::|:  :||.|....|::
 Worm   356 STLYQSFYNLIYSLEDQLDRIHNSRRRGAGYR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 28/60 (47%)
Ion_trans_2 292..377 CDD:285168 27/108 (25%)
twk-45NP_001122742.2 Ion_trans_2 <185..241 CDD:285168 27/55 (49%)
Ion_trans_2 278..354 CDD:285168 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.