DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-49

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001022268.1 Gene:twk-49 / 187626 WormBaseID:WBGene00019904 Length:337 Species:Caenorhabditis elegans


Alignment Length:231 Identity:61/231 - (26%)
Similarity:95/231 - (41%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRRSSFRRREKPAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKSEK 66
            :||.||..|  .|.|:|            :|.|.:|||.|.:|:.||..|     :.:||    .
 Worm    31 TSRISSATR--SPCFQR------------WSPVLLILLTTVFILFGATCF-----YLFER----D 72

  Fly    67 PHRFIA-----------RNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLD-YQRAIVKKQL 119
            ||....           |.|:....|||:..|...:...|.. ...||..:|:: .:|...|..:
 Worm    73 PHEMTVRKWYMNLAVERRQFARTISSRIFNDTRNLLIIIDRE-QTERVQQLLVESLKRYEDKLTI 136

  Fly   120 KGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKS 184
            ..|...:||:..:|.::.:::.|||.|...|.:...::..:.|.:||:|||              
 Worm   137 VPPSRREWSWISSFNFAYSLLLTIGGGFKVPATVGSQIFAVFYCLIGIPLF-------------- 187

  Fly   185 FKWIYSKVCL--CRICPGVAK-RRIIRERRKMRQLA 217
                ||.:.|  ||:...|.| ..:.|.||.:..||
 Worm   188 ----YSTLILIVCRLVSPVLKWPSLTRSRRFLLILA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 14/59 (24%)
Ion_trans_2 292..377 CDD:285168
twk-49NP_001022268.1 Ion_trans_2 <144..191 CDD:369572 16/64 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.