DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-29

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001021467.1 Gene:twk-29 / 185828 WormBaseID:WBGene00006681 Length:476 Species:Caenorhabditis elegans


Alignment Length:369 Identity:83/369 - (22%)
Similarity:146/369 - (39%) Gaps:128/369 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYR 100
            |:.|:.:..||| |||.:.| |||:        :::.:|.:.|     ..|..|::...|:....
 Worm    56 IVFLIIYTTIGG-FIFLNFE-FEYQ--------QYMKQNATLE-----KRLCIESLLNRDNRLRL 105

  Fly   101 RRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAII 165
            .|.:||........:.:.:| .|..||||..|.||||.::||:|||.|.|.:..|::.|::|...
 Worm   106 TRASDVAAAIAERCLTENVK-DDRMQWSFKSAALYSLGILTTLGYGKIEPQTINGRISTVIYGFF 169

  Fly   166 GMPLFLLYLSNIG---DVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMEN 227
            |:||.::.|:|.|   :.:|..|                  ||:|..||:...        :.||
 Worm   170 GIPLTVILLTNFGRYLEAMATRF------------------RRLISCRRRRED--------EDEN 208

  Fly   228 ARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVF 292
            ..||:.:                                                         |
 Worm   209 VSGSTLF---------------------------------------------------------F 216

  Fly   293 VMVGYILWGA----LLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILC 353
            :::.|::.||    |:.|:::   :.:|.|:..|.|::|.:||::|.:.....          :.
 Worm   217 IVLVYLILGATMIPLMSGQFD---FFNGIYYAFICLTAIEYGDIIPQNNWFLP----------IS 268

  Fly   354 AIYLLLGMAV--IAMCFNLMQEQVVH-------NIRAIKRGFKA 388
            ..|:..|:|:  ||:....:..:.:|       ||..|:..|.|
 Worm   269 VFYMCTGLAISTIALDIGSIYVRKLHFIGKKIKNIANIRIWFGA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 26/62 (42%)
Ion_trans_2 292..377 CDD:285168 19/90 (21%)
twk-29NP_001021467.1 Ion_trans_2 127..186 CDD:285168 26/58 (45%)
Ion_trans_2 216..292 CDD:285168 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.