DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-35

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_508031.3 Gene:twk-35 / 185149 WormBaseID:WBGene00006687 Length:557 Species:Caenorhabditis elegans


Alignment Length:395 Identity:88/395 - (22%)
Similarity:152/395 - (38%) Gaps:130/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILLVTF--YIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAY 99
            :|::.|  |.|.|..:|..||    |..:||              |...|:...||.......|.
 Worm   145 VLIIVFLIYCISGGLVFWLIE----EPYQSE--------------LRDAWQHKIENNRTARVDAM 191

  Fly   100 RRRV--NDVLLDYQRAIVKKQLKGPDVEQ------------------WSFSGAFLYSLTVITTIG 144
            .:::  |...|.|.:....::|....:|:                  |.|..|.|::.|:.||||
 Worm   192 MKKIFNNSDYLIYIKGNTSQRLTTFFIEELGSYENQLGVKWSQQKMDWDFWNAVLFAGTICTTIG 256

  Fly   145 YGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVL--AKSFKWIYSKVCLCRICPGVAKRRII 207
            ||:|.|.::.|:::|:::|:.|:||.||.|.:.|.:|  ...|.|..:|                
 Worm   257 YGHIYPMTDAGRMLTMIFALFGIPLMLLVLQDFGKLLTITMKFPWFQTK---------------- 305

  Fly   208 RERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDI 272
               |.||::.|......:|..:                                         :|
 Worm   306 ---RLMRRIMRCCTKQPIEEMK-----------------------------------------EI 326

  Fly   273 EREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWE-DWNYLDGSYFCLISLSSIGFGDLVPGD 336
            ||:.|...|...:|:.|.:.::|.:|...:.:...|: :|..|:..||...|||::|.|||||..
 Worm   327 ERQERHDLDIFDLPLPVGIALIVTWIFICSFVLSVWDHNWTLLESFYFFFTSLSTVGLGDLVPSS 391

  Fly   337 -RVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQV---------------VHNIRAIKRG 385
             |::           |....::|:|:::::|..||:|.::               :|.......|
 Worm   392 PRLL-----------ITMFGFILVGLSLVSMVINLLQAKMKSTYEAGRNDEKTPHIHQTLPTSLG 445

  Fly   386 FKACF 390
            ...||
 Worm   446 VLQCF 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 25/79 (32%)
Ion_trans_2 292..377 CDD:285168 24/101 (24%)
twk-35NP_508031.3 Ion_trans_2 <237..294 CDD:285168 23/56 (41%)
Ion_trans_2 347..420 CDD:285168 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.