DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-37

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_491810.2 Gene:twk-37 / 183583 WormBaseID:WBGene00006689 Length:382 Species:Caenorhabditis elegans


Alignment Length:388 Identity:80/388 - (20%)
Similarity:129/388 - (33%) Gaps:143/388 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RREKPAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIE------IFEYER-LKSEKP 67
            |.|:|...:.:...|....|. :.:..::||. ||||||.:|..||      |.|::| ::.:..
 Worm    74 RAERPKPTKLRTILRKIRKFN-TIIAFVVLVA-YIIGGALLFWQIESRSDMNINEFKRNIRQKSI 136

  Fly    68 HRFIA-------------RNFSGECLSRIWELT-AENISFFDHHAYRRRVNDVLLDYQRAIVKKQ 118
            |.:.:             ...:..|:..|::|. |.|                            
 Worm   137 HIYNSMKGSKCGKLKKADNELNNNCIKEIFDLLYASN---------------------------- 173

  Fly   119 LKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAK 183
               |......|.....|.:|.|||||||.:..|:..|||||:.|.|||:.|.|..|.|.|.:..|
 Worm   174 ---PPKHIEEFLDGLAYVITCITTIGYGELVCHTIAGKLVTVAYGIIGIALTLYVLRNNGKITLK 235

  Fly   184 SFKWIYSKVCLC-RICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSS 247
            ..........:| |.|                             .:.|:.|..|          
 Worm   236 ICNLTLKIFAICVRKC-----------------------------GKKSAKYKMT---------- 261

  Fly   248 SEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWN 312
                                                   |.....::|.:..:|||....:|::.
 Worm   262 ---------------------------------------VLKAFILLVTFWGFGALAIAVYEEFV 287

  Fly   313 YLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQV 375
            :.|..||...:.|:|||||.||...:         ...|:|.:: .:.:::|:|...|:...:
 Worm   288 FYDALYFSFSTFSTIGFGDFVPSGHI---------SGTIICVLH-FIDLSLISMVLVLVHHSM 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 25/59 (42%)
Ion_trans_2 292..377 CDD:285168 21/84 (25%)
twk-37NP_491810.2 Ion_trans_2 <181..235 CDD:285168 25/53 (47%)
Ion_trans_2 267..336 CDD:285168 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.