DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and C27F2.6

DIOPT Version :10

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_498055.1 Gene:C27F2.6 / 182966 WormBaseID:WBGene00016168 Length:165 Species:Caenorhabditis elegans


Alignment Length:41 Identity:14/41 - (34%)
Similarity:24/41 - (58%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 ILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRV 338
            :|..:.||...|:.:|...:||..:::..|.|||:||.:.|
 Worm    33 LLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPTNLV 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 <127..183 CDD:462301
Ion_trans_2 292..376 CDD:462301 14/41 (34%)
C27F2.6NP_498055.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.