powered by:
Protein Alignment sand and C27F2.6
DIOPT Version :9
Sequence 1: | NP_610349.1 |
Gene: | sand / 35777 |
FlyBaseID: | FBgn0033257 |
Length: | 395 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498055.1 |
Gene: | C27F2.6 / 182966 |
WormBaseID: | WBGene00016168 |
Length: | 165 |
Species: | Caenorhabditis elegans |
Alignment Length: | 41 |
Identity: | 14/41 - (34%) |
Similarity: | 24/41 - (58%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 ILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRV 338
:|..:.||...|:.:|...:||..:::..|.|||:||.:.|
Worm 33 LLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPTNLV 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
sand | NP_610349.1 |
Ion_trans_2 |
123..183 |
CDD:285168 |
|
Ion_trans_2 |
292..377 |
CDD:285168 |
14/41 (34%) |
C27F2.6 | NP_498055.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1418 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.