Sequence 1: | NP_610349.1 | Gene: | sand / 35777 | FlyBaseID: | FBgn0033257 | Length: | 395 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001370323.1 | Gene: | B0310.1 / 181922 | WormBaseID: | WBGene00015137 | Length: | 292 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 43/195 - (22%) |
---|---|---|---|
Similarity: | 77/195 - (39%) | Gaps: | 43/195 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PAFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSI------------EIFEYERLKSEK 66
Fly 67 PHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSG 131
Fly 132 AFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFK----WIYSKV 192
Fly 193 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sand | NP_610349.1 | Ion_trans_2 | 123..183 | CDD:285168 | 21/59 (36%) |
Ion_trans_2 | 292..377 | CDD:285168 | |||
B0310.1 | NP_001370323.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |