DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-22

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001361830.1 Gene:twk-22 / 181703 WormBaseID:WBGene00006675 Length:749 Species:Caenorhabditis elegans


Alignment Length:396 Identity:104/396 - (26%)
Similarity:166/396 - (41%) Gaps:111/396 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 REKPAFERFKDHCRHFTAFMFSNVGIIL---------LVTFYIIG----GAFIFQSIEIFEYER- 61
            ||....|.||...|......|..||..|         |:...|:|    |.:||.::   ||:: 
 Worm   141 RESTIREEFKQQYRETWGHWFVRVGKFLYKLLGIQYMLLALMILGYACLGGYIFLTL---EYDQQ 202

  Fly    62 ---LKSEKPHRFIARNFSGECLSRI---WELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLK 120
               |:.||..|........|.|.:.   |.....|            .|..|....:|.:::.:|
 Worm   203 QLDLEVEKQVRLSESTLLAENLLKYLKQWNCGQSN------------ENRCLELITKAFIERSIK 255

  Fly   121 GPDVE--------QWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNI 177
               ||        :|.|..:..:|.|:.|||||||:...:..|::.||:|.:||:||.|..|...
 Worm   256 ---VERDIRGEGWRWDFWNSVFFSATIFTTIGYGNLACKTNLGRVATIIYGLIGIPLMLFVLKIF 317

  Fly   178 GDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTS 242
            |:   .|.||. .||       ..:.||.::...:..:|.||                ||..:.:
 Worm   318 GE---HSIKWA-QKV-------RYSIRRCVKRCFRRSKLKRA----------------STIESVA 355

  Fly   243 SNSSSSEYTRSSRQSSSLVDIQYTESD-SDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFG 306
            |:....|                 ||. |:.|.:|      .|.||...:|::..:::..:|:..
 Worm   356 SDEMPCE-----------------ESGISEDEEQI------TTFPVKWALFIVFFFMVVCSLIVS 397

  Fly   307 RWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLL--LGMAVIAMCFN 369
            .||.|::|...||..:|||:|||||::| :...||           ||:::|  :|:|:.:|.:.
 Worm   398 FWEKWDFLTAFYFFFVSLSTIGFGDVIP-EHPRTA-----------CALFVLYFVGLALFSMVYA 450

  Fly   370 LMQEQV 375
            ::||:|
 Worm   451 ILQERV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 24/67 (36%)
Ion_trans_2 292..377 CDD:285168 28/86 (33%)
twk-22NP_001361830.1 Ion_trans_2 259..319 CDD:369572 21/59 (36%)
Ion_trans_2 381..457 CDD:369572 28/88 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.