DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-20

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_510284.1 Gene:twk-20 / 181485 WormBaseID:WBGene00006673 Length:364 Species:Caenorhabditis elegans


Alignment Length:345 Identity:82/345 - (23%)
Similarity:135/345 - (39%) Gaps:117/345 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTF-YIIGGAFIFQSIEI-------FEYERLKSEKPHRFIARNFSGECLSRIWELTAENIS 92
            :::|.|| |::.||.:|..:|.       .|.||:.....|::   |||..              
 Worm    13 LLILSTFTYLLFGAMVFDKLESEKDTWVRDEIERITDRLKHKY---NFSER-------------- 60

  Fly    93 FFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKL 157
              |.|.:            .||..|.:......||.|:|||.::..||||:|||:..|.:..|||
 Worm    61 --DLHLF------------EAIAIKSIPQQAGYQWQFAGAFYFATVVITTVGYGHSAPSTNAGKL 111

  Fly   158 VTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQM 222
            ..:::|:.|:|:.|:...:||:                |:...:                 |..:
 Worm   112 FCMIFALFGVPMGLIMFQSIGE----------------RVNTFI-----------------AYSL 143

  Fly   223 HDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPV 287
            |...::.....:|.....|                                     .|..:.|.:
 Worm   144 HKFRDSLHQQGFTCLQEVT-------------------------------------PTHLLMVSL 171

  Fly   288 TVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFIL 352
            |:...|:|.    |..:|...|.|:..|..|||:|:.|:||||||||..:| .|.:|  :..::.
 Worm   172 TIGFMVIVS----GTYMFHTIEKWSIFDAYYFCMITFSTIGFGDLVPLQQV-NALQD--QPLYVF 229

  Fly   353 CAI-YLLLGMAVIAMCFNLM 371
            ..| ::|:|:||.:.|.||:
 Worm   230 ATIMFILIGLAVFSACVNLL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 23/59 (39%)
Ion_trans_2 292..377 CDD:285168 31/81 (38%)
twk-20NP_510284.1 Ion_trans_2 <80..135 CDD:285168 23/70 (33%)
Ion_trans_2 175..250 CDD:285168 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.