DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-44

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_509942.4 Gene:twk-44 / 181349 WormBaseID:WBGene00006694 Length:733 Species:Caenorhabditis elegans


Alignment Length:374 Identity:84/374 - (22%)
Similarity:148/374 - (39%) Gaps:113/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HCRHFTAF----MFSNVGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGE---- 78
            |.|.:..|    :..:|....|.|||:       ...|:.:...|:.:.|.:...|:|...    
 Worm   141 HYRGYRKFALNQIHKSVYWYTLSTFYL-------TEHEMHKVVALRPKNPEQLWKRHFESNFGRI 198

  Fly    79 ----------CLSRIWELTAENIS-FFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGA 132
                      || |.|||..|..: .:..:.|...||..:.:|..::....:..|   .|:|..|
 Worm   199 RALKNYTEQLCL-RCWELGVEGANQGWTRYNYSLMVNQSVEEYNNSVGLGHVLTP---VWTFWNA 259

  Fly   133 FLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFK--WIYSKVCLC 195
            ...::|..|||||||||..::.|||..::||::|:||.|:.|...|.:.....:  |.:......
 Worm   260 MFLAVTTYTTIGYGNITAKTKLGKLAAMVYAVVGIPLVLMILHKSGRLFLMGLEHMWDFILRITD 324

  Fly   196 RICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSL 260
            ..|.|..|:|:                                             |::.:    
 Worm   325 SFCVGSGKQRV---------------------------------------------RNTGE---- 340

  Fly   261 VDIQYTESDSDIEREIRGSTDEIT-VPVTVCVFVMVGYILWGALLFGRWE-DWNYLDGSYFCLIS 323
                                |.|: :|:.:.:.|..|::...|.:|.|:| ||:|....||...|
 Worm   341 --------------------DRISEMPLILAIGVAFGWMFLCAAIFLRFEKDWDYFKSFYFFFCS 385

  Fly   324 LSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQ 372
            |::||:||:.|.:.         |..||:..: :::|:::::||.|::|
 Worm   386 LTTIGYGDVTPTNS---------EDMFIIFGL-IIIGLSLVSMCINVIQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 24/59 (41%)
Ion_trans_2 292..377 CDD:285168 26/82 (32%)
twk-44NP_509942.4 Ion_trans_2 237..308 CDD:285168 26/73 (36%)
Ion_trans_2 354..>397 CDD:285168 17/42 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.