DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-24

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001367093.1 Gene:twk-24 / 179682 WormBaseID:WBGene00006677 Length:579 Species:Caenorhabditis elegans


Alignment Length:387 Identity:97/387 - (25%)
Similarity:165/387 - (42%) Gaps:76/387 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIGGAFIFQSIE--------IFEYERLKSEKPHRFIARNFSGECLSRIWELTAENIS 92
            :::|.:|.:.||. ||.:||        |.::|..|.....|.|   :..:...|:.|:..:|.:
 Worm   121 LVVLFSFSLFGGV-IFSAIEGGYETTQLIKKFEHEKDVYERRKI---YQEQLFQRLREIEHDNTN 181

  Fly    93 FFDHHAYRRRVNDVLLDYQRAIVK--KQLKGPDVEQ-------WSFSGAFLYSLTVITTIGYGNI 148
            ....::.|....   |:..|..::  :|..|..:|:       |:..|...||.::.|||||||.
 Worm   182 PRGRNSSREHFK---LEQSRHALEWYEQKMGVTIEEPQMRETKWNLWGGVYYSASLYTTIGYGNF 243

  Fly   149 TPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWI----------YSKVCLCRICPGVAK 203
            .|.::.|::::::||.||:||....|.:.|.:.   |.||          :.:..|.|    ..:
 Worm   244 HPLTKSGRIISMMYACIGIPLVFTILLDWGFLY---FTWIEYGWNRFNENFCQKSLQR----DMQ 301

  Fly   204 RRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSL-VDIQYTE 267
            |||.|||  :|::...|.:        ||:......||:..|:..::..|:...|.| ||:...|
 Worm   302 RRIRRER--IRRVGSELSL--------SSTAPLLHRTTTQLSNPVQHIESNHPLSPLDVDVPMGE 356

  Fly   268 SDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWE-DWNYLDGSYFCLISLSSIGFGD 331
            ...             |||:.........:|:..|.:...|| :|.|....||...||::||.||
 Worm   357 QVQ-------------TVPIKSAAIFFFLWIMISAFIVRLWEYEWTYFTAFYFFFTSLTTIGLGD 408

  Fly   332 LVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKRGFKACFRCR 393
            :|          .|.....|......|:|::|:.:|..::|.:|......:.|...|.:|.|
 Worm   409 VV----------TKTPNFIIFNLAMTLIGLSVVGLCAAIVQAKVKLVFDRMLRSIDAQYRIR 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 22/66 (33%)
Ion_trans_2 292..377 CDD:285168 23/85 (27%)
twk-24NP_001367093.1 Ion_trans_2 <221..273 CDD:400301 20/51 (39%)
Ion_trans_2 368..442 CDD:400301 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2863
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.