DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and egl-23

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001255775.1 Gene:egl-23 / 178358 WormBaseID:WBGene00001190 Length:726 Species:Caenorhabditis elegans


Alignment Length:426 Identity:94/426 - (22%)
Similarity:169/426 - (39%) Gaps:152/426 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MFSNVGIILLVTFYIIGGAFIFQSIEI---------------------FEY-------------- 59
            :|.:..:|:.|..|.|.||.:.:|:|.                     |::              
 Worm    58 LFVHFLMIVSVGAYAIFGALVMRSLESRTVTSIEKKTDVHRRHVNLTNFQHPPTPITLEQRHRRR 122

  Fly    60 -------------ERLKSEK---PHRFIARNFSGEC-LSRIWELTAENISF-------------- 93
                         |:|..||   .|  |.|  |.:| :|.|.::::...||              
 Worm   123 RRHNETALEDHLSEKLSREKRAAAH--IMR--SRKCVISVIKKMSSMECSFDTLDEKLVKALDEC 183

  Fly    94 ----FDHHAYRRRVNDVLLDYQRAIVKK--QLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHS 152
                .:|:.:   ||.||....:..|:.  :....||.:|||..:.|::.||||||||||:.|.:
 Worm   184 YHVAVEHNTH---VNHVLFTNSKEEVESVGEEAEEDVSEWSFMDSLLFAFTVITTIGYGNVAPRT 245

  Fly   153 ECGKLVTILYAIIGMPLFLLYLSNIGD------VLAKSFKWIYSKVCLCRICPGVAKRRIIRERR 211
            ..|:|..|.|.:||:|..||.::::|.      |.||||            |           |:
 Worm   246 FGGRLFVIGYGLIGIPFTLLAIADLGKFISEMMVEAKSF------------C-----------RK 287

  Fly   212 KMRQLARA-----LQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSD 271
            ..::|.:|     ::..|:                 ||:...|         .::|.:..|::.:
 Worm   288 TWKKLKKAWNPNFIRAKDL-----------------SNTDIEE---------KILDNEKIENEPE 326

  Fly   272 IEREIRGSTDEITVPVTVCVFVM-VGYILWGALLFGRWE-DWNYLDGSYFCLISLSSIGFGDLVP 334
            .. |:....|::|......:|:: :.||.:|..:...:| |.::....||..::|:|||.||:||
 Worm   327 TS-EVSEEEDDLTETEATSLFILFLVYIAFGGFMLAAYEPDMDFFKAVYFNFVTLTSIGLGDIVP 390

  Fly   335 GDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNL 370
                      :.|...::..:|:.:|:|:..:...:
 Worm   391 ----------RSETYMLITIVYIAIGLALTTIAIEI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 28/65 (43%)
Ion_trans_2 292..377 CDD:285168 20/81 (25%)
egl-23NP_001255775.1 Ion_trans_2 216..276 CDD:285168 27/59 (46%)
Ion_trans_2 347..423 CDD:285168 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.