DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-5

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001021896.1 Gene:twk-5 / 174756 WormBaseID:WBGene00006660 Length:281 Species:Caenorhabditis elegans


Alignment Length:353 Identity:65/353 - (18%)
Similarity:109/353 - (30%) Gaps:177/353 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYR 100
            |:|::|..::.||.|||||:                                             
 Worm    20 IVLILTTLMLVGAAIFQSID--------------------------------------------- 39

  Fly   101 RRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAII 165
                                 |.:.:.||.....:....|:||||||..|.:...::.:|.::|:
 Worm    40 ---------------------PVLGEQSFYEVVFFEFITISTIGYGNQYPQTHASRVFSIFFSIL 83

  Fly   166 GMPLFLLYLSNIGDVLAKSF----KWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDME 226
            |:||.::.|.|.|..|.|.:    .||:|                  ||                
 Worm    84 GIPLLVVTLGNFGKYLTKFYWKTHGWIFS------------------ER---------------- 114

  Fly   227 NARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCV 291
                                                   |||:...::::.|.       |..|:
 Worm   115 ---------------------------------------TESELVNDKDMPGI-------VIACL 133

  Fly   292 FVM---VGYIL---WGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSF 350
            :::   :|:..   .||..        .:|..||..||.:::||||.||  ::.|.::      |
 Worm   134 YLLTFAIGFFFIPHSGAAY--------SIDDCYFSFISFATVGFGDKVP--QIDTFEK------F 182

  Fly   351 ILCAIYLLLGMAVIAMCFNLMQEQVVHN 378
            .....||:.|..:     |:|....|.|
 Worm   183 CKVITYLVWGTIL-----NIMLISYVTN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 19/59 (32%)
Ion_trans_2 292..377 CDD:285168 21/90 (23%)
twk-5NP_001021896.1 Ion_trans_2 22..101 CDD:285168 29/144 (20%)
Ion_trans_2 135..209 CDD:285168 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.