DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and twk-3

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_495727.1 Gene:twk-3 / 174321 WormBaseID:WBGene00006658 Length:383 Species:Caenorhabditis elegans


Alignment Length:375 Identity:70/375 - (18%)
Similarity:132/375 - (35%) Gaps:148/375 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NVGIILLVTFYIIGGAFIFQSIE-----------IFEYERLKSEKPHRFIARNFSGECLSRIWEL 86
            :.|::|....|.:|||::|.|||           |.|::.||.:         |.|...|.| |.
 Worm    41 HTGLVLSCVTYALGGAYLFLSIEHPEELKRREKAIREFQDLKQQ---------FMGNITSGI-EN 95

  Fly    87 TAENISFFDHHAYRRRVNDVLLDYQRA-----------IVKKQLKGPDVEQWSFSGAFLYSLTVI 140
            :.::|..     |.:::..:|.|...|           |.|        :.|:||.|.:::.|.:
 Worm    96 SEQSIEI-----YTKKLILMLEDAHNAHAFEYFFLNHEIPK--------DMWTFSSALVFTTTTV 147

  Fly   141 TTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSF-KWIYSKVCLCRICPGVAKR 204
            ..:|||.|.|.|..|::..|.||::|:||.|:.:::.|...|:.. :|.                
 Worm   148 IPVGYGYIFPVSAYGRMCLIAYALLGIPLTLVTMADTGKFAAQLVTRWF---------------- 196

  Fly   205 RIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESD 269
                                                                             
 Worm   197 ----------------------------------------------------------------- 196

  Fly   270 SDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVP 334
                     ..:.:.:|..:.|.::..|.|....:.....:..|||..||.|.|:.:||||||.|
 Worm   197 ---------GDNNMAIPAAIFVCLLFAYPLVVGFILCSTSNITYLDSVYFSLTSIFTIGFGDLTP 252

  Fly   335 GDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKR 384
                        :::.|...::|.:|:.::.:..:::..:::..:..:.|
 Worm   253 ------------DMNVIHMVLFLAVGVILVTITLDIVAAEMIDRVHYMGR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 20/59 (34%)
Ion_trans_2 292..377 CDD:285168 19/84 (23%)
twk-3NP_495727.1 Ion_trans_2 <134..190 CDD:285168 20/55 (36%)
Ion_trans_2 211..283 CDD:285168 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.