DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and sup-9

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:344 Identity:81/344 - (23%)
Similarity:137/344 - (39%) Gaps:117/344 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWE--LTAENISFFDH 96
            :.:|:....|::.||.:|.::|. |.|.|:.             :.:.|:.|  .|..|:|..|:
 Worm     9 LSLIVCTLTYLLVGAAVFDALET-ENEILQR-------------KLVQRVREKLKTKYNMSNADY 59

  Fly    97 HAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTIL 161
                    ::|    .|.:.|.:......||.|||||.::.|||||||||:.||.::.||:..:|
 Worm    60 --------EIL----EATIVKSVPHKAGYQWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCML 112

  Fly   162 YAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDME 226
            ||:.|:||.|:...:||:.:                                             
 Worm   113 YALAGIPLGLIMFQSIGERM--------------------------------------------- 132

  Fly   227 NARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCV 291
                             |:.:::..|..|:::....| .|.||                    .:
 Worm   133 -----------------NTFAAKLLRFIRRAAGKQPI-VTSSD--------------------LI 159

  Fly   292 FVMVGY----ILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFIL 352
            ....|:    |..||.:|..:|:|.|.|..|:|.::|::|||||.|...:..:.......|.|.|
 Worm   160 IFCTGWGGLLIFGGAFMFSSYENWTYFDAVYYCFVTLTTIGFGDYVALQKRGSLQTQPEYVFFSL 224

  Fly   353 CAIYLLLGMAVIAMCFNLM 371
              :::|.|:.||:...||:
 Worm   225 --VFILFGLTVISAAMNLL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 29/59 (49%)
Ion_trans_2 292..377 CDD:285168 27/84 (32%)
sup-9NP_494333.1 Ion_trans_2 <77..132 CDD:311712 29/54 (54%)
Ion_trans_2 168..242 CDD:311712 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.