DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk7

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_034739.2 Gene:Kcnk7 / 16530 MGIID:1341841 Length:343 Species:Mus musculus


Alignment Length:375 Identity:79/375 - (21%)
Similarity:133/375 - (35%) Gaps:141/375 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIG-GAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAY 99
            ::|:.....:| ||.:.|::|         ..|    ||:...:..:.:....||:.:.....| 
Mouse    12 LLLMAHLLAMGLGAVVLQALE---------GPP----ARHLQAQVQAELASFQAEHRACLPPEA- 62

  Fly   100 RRRVNDVLLDYQRAIVKKQLKG-------PDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKL 157
                   |.:...|:::.|..|       .:...|....|.|::.:::||.|||::.|.|..||.
Mouse    63 -------LEELLGAVLRAQAHGVSSLGNSSETSNWDLPSALLFTASILTTTGYGHMAPLSSGGKA 120

  Fly   158 VTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPG--VAKRRIIRERRKMRQLARAL 220
            ..::||.:|:|..|..::.:...|..    ::|:       ||  ||.|         .|||.| 
Mouse   121 FCVVYAALGLPASLALVAALRHCLLP----VFSR-------PGDWVAIR---------WQLAPA- 164

  Fly   221 QMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITV 285
                                          ..:..|::.|                 |.      
Mouse   165 ------------------------------QAALLQAAGL-----------------GL------ 176

  Fly   286 PVTVCVFVMV-GYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVP-------------GD 336
             :..|||::: ..:|||.     ..|.:.|:..|||..|||:||.|||:|             | 
Mouse   177 -LVACVFMLLPALVLWGV-----QGDCSLLEAIYFCFGSLSTIGLGDLLPAHGRGLHPAIYHLG- 234

  Fly   337 RVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKRGF 386
                        .|.|.. |||||:..:.:......|  :..:||:.:.|
Mouse   235 ------------QFALLG-YLLLGLLAMLLAVETFSE--LPQVRAMVKFF 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 18/59 (31%)
Ion_trans_2 292..377 CDD:285168 27/98 (28%)
Kcnk7NP_034739.2 Ion_trans_2 <89..140 CDD:285168 17/50 (34%)
Ion_trans_2 178..>225 CDD:285168 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.