DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk5

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_067517.1 Gene:Kcnk5 / 16529 MGIID:1336175 Length:502 Species:Mus musculus


Alignment Length:360 Identity:83/360 - (23%)
Similarity:140/360 - (38%) Gaps:128/360 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VTFYIIGGAFIFQSIEIFEYERLK----SEKPHRFIARNF---SGECLSRIWELTAENISFFDHH 97
            :.||:..||.||:.:|...::..|    ::|.|  :.:.|   |.|.|.:|.::.::        
Mouse    12 IIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLH--LLKEFPCLSQEGLDKILQVVSD-------- 66

  Fly    98 AYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILY 162
                     ..|...||...|    ....|::..|.:::.||||||||||:.|.:..|:|..:.|
Mouse    67 ---------AADQGVAITGNQ----TFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFY 118

  Fly   163 AIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMEN 227
            .:.|:||.|.::|.:|                 :...|.|||           |.:.|       
Mouse   119 GLFGVPLCLTWISALG-----------------KFFGGRAKR-----------LGQFL------- 148

  Fly   228 ARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVF 292
                                      :|:..||...|.|                       |..
Mouse   149 --------------------------TRRGVSLRKAQIT-----------------------CTA 164

  Fly   293 VMVGYILWGAL--------LFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVS 349
            :   :|:||.|        :|...|:|||::|.|:..|::|:|||||.|.|... :|:...:...
Mouse   165 I---FIVWGVLVHLVIPPFVFMVTEEWNYIEGLYYSFITISTIGFGDFVAGVNP-SANYHALYRY 225

  Fly   350 FILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKR 384
            |:  .:::.||:|.:::..|......|...:|||:
Mouse   226 FV--ELWIYLGLAWLSLFVNWKVSMFVEVHKAIKK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 22/59 (37%)
Ion_trans_2 292..377 CDD:285168 26/92 (28%)
Kcnk5NP_067517.1 Ion_trans_2 <81..137 CDD:285168 22/72 (31%)
Ion_trans_2 171..243 CDD:285168 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.