DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:362 Identity:81/362 - (22%)
Similarity:131/362 - (36%) Gaps:125/362 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LVTF--YIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYRR 101
            ||.:  |:..||.:...:|.....||::|              |..:.|....:......||...
  Rat    11 LVAYAGYLALGALLVARLERPHEARLRAE--------------LGTLREQLLRHSPCVAAHALDA 61

  Fly   102 RVNDVLLDYQ--RAIVKKQLKGP---DVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTIL 161
            .|..||...:  ||:: ....||   ....|.|:.|..::.|::||:|||..||.::.||..:|:
  Rat    62 FVERVLAAGRLGRAVL-ANASGPANASDPAWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSIV 125

  Fly   162 YAIIGMPLFLLYLSNIGDVLA----------KSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQL 216
            :|::|:|:.:|.|:.....|:          .|.:|.:..                         
  Rat   126 FALLGVPITMLLLTASAQRLSLLLTHAPLSWLSLRWGWHP------------------------- 165

  Fly   217 ARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTD 281
            .||.:.|                                    ||.:                  
  Rat   166 QRAARWH------------------------------------LVAL------------------ 176

  Fly   282 EITVPVTVCVFVMVGYILWGALLFGRWED-WNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDK 345
               :.|.|.:|.::     .|.:|...|: |::||..|||.||||:||.||.|||:......|..
  Rat   177 ---LMVIVAIFFLI-----PAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRSL 233

  Fly   346 VEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAI 382
            .:|   |...||.||:  :||...|...:.|.::..:
  Rat   234 YKV---LVTAYLFLGL--VAMVLVLQTFRRVSDLHGL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 20/69 (29%)
Ion_trans_2 292..377 CDD:285168 31/85 (36%)
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 19/54 (35%)
Ion_trans_2 180..259 CDD:400301 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10303
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.