DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk4

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_006230696.1 Gene:Kcnk4 / 116489 RGDID:621449 Length:423 Species:Rattus norvegicus


Alignment Length:383 Identity:83/383 - (21%)
Similarity:137/383 - (35%) Gaps:150/383 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHA 98
            :.::.||..|::.||.:||::          |:||....:.          :|......|...|.
  Rat    33 LALLALVLLYLVSGALVFQAL----------EQPHEQQVQK----------DLEDGRDQFLKDHP 77

  Fly    99 YRRRVNDVLLDYQRAIVKKQLKG---PDV---------EQWSFSGAFLYSLTVITTIGYGNITPH 151
            ...:.|   |:....:|.:.|.|   |:.         ..|:...||.:|.|:|||||||||..|
  Rat    78 CVSQKN---LEGFIKLVAEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIALH 139

  Fly   152 SECGKLVTILYAIIGMPLFLLYLSNIGDVLAKS------------FKWIYSKVCLCRICPGVAKR 204
            ::.|:|..|.||::|:|||.:.|:.:||.|..|            .||        .:.||:   
  Rat   140 TDAGRLFCIFYALVGIPLFGMLLAGVGDRLGSSLRRGIGHIEAVFLKW--------HVPPGL--- 193

  Fly   205 RIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESD 269
                    :|.|:..|                                                 
  Rat   194 --------VRMLSAVL------------------------------------------------- 201

  Fly   270 SDIEREIRGSTDEITVPVTVCVFVMVG---YILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGD 331
                                  |:::|   ::|....:|...|.|:.|:..||.:::|:::||||
  Rat   202 ----------------------FLLIGCLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGD 244

  Fly   332 LVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHN-IRAIKRGFKA 388
            .||||.  |..........:.  .::|.|:|..|....     .:.| :||:.|..:|
  Rat   245 YVPGDG--TGQNSPAYQPLVW--FWILFGLAYFASVLT-----TIGNWLRAVSRRTRA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 28/68 (41%)
Ion_trans_2 292..377 CDD:285168 23/87 (26%)
Kcnk4XP_006230696.1 Ion_trans_2 <115..169 CDD:285168 27/53 (51%)
Ion_trans_2 207..285 CDD:285168 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9664
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.