DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and Kcnk4

DIOPT Version :10

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_006230696.1 Gene:Kcnk4 / 116489 RGDID:621449 Length:423 Species:Rattus norvegicus


Alignment Length:174 Identity:39/174 - (22%)
Similarity:67/174 - (38%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SALQQQSKSFQKRDIEQLLKAALGCADSTQKYTPSSDTSSFLHSDDSNDSSRLLIASESDHSDTQ 93
            ||.:.:|:|.:.|              .::.::.:|..|....|...:.|:.....|.|...:..
  Rat   191 SASRSRSRSRRSR--------------RSRSHSRTSSRSGASGSRSRSRSTSKKAKSRSSRMEES 241

  Fly    94 SNHSEQSESSGATFTSTTSTLN------------DSRSVTVMKKLHPSRPLSRWHSL----VAAN 142
            ||.:.:...||...:.:.|..|            ||||.: ..|....|.|||....    .:.:
  Rat   242 SNGARKGGDSGRDNSLSRSPQNKKSKRENKRGRSDSRSRS-RSKSRNDRDLSRESGSKSQEASKS 305

  Fly   143 NEEIPIVYHKSMARQFPVKDRTPEQMEMRRRNTEAARVSRAKSK 186
            .:|.....|:|.|.. ..:.:||...:.||.:...:| ||:||:
  Rat   306 GDEGRAGTHRSRAHS-RSRSQTPPNADQRRESRSRSR-SRSKSR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 <127..183 CDD:462301 14/59 (24%)
Ion_trans_2 292..376 CDD:462301
Kcnk4XP_006230696.1 Ion_trans_2 <111..169 CDD:462301
Ion_trans_2 207..285 CDD:462301 16/78 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.