DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk10

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_002933240.1 Gene:kcnk10 / 100497885 XenbaseID:XB-GENE-950562 Length:545 Species:Xenopus tropicalis


Alignment Length:368 Identity:84/368 - (22%)
Similarity:142/368 - (38%) Gaps:124/368 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VGIILLVTFYIIGGAFIFQSIEIFEYERLKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHA 98
            :.|.:||..|::.|..:|.::|      ...|...::|              :..|...|..:|.
 Frog    83 LAIFVLVVLYLVTGGLVFGALE------QPFENSQKYI--------------IAQEKADFLLNHP 127

  Fly    99 YRRRVNDVLLDYQRAIVKKQLKGPDV------------EQWSFSGAFLYSLTVITTIGYGNITPH 151
            .   |....||   |::|:.:...:.            ..|....||.::.|||||||:|||.|.
 Frog   128 C---VTQQELD---ALIKRAIDADNAGVNPIGNNSNSSSHWDIGSAFFFAGTVITTIGFGNIAPS 186

  Fly   152 SECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQL 216
            :|.||:..|||||.|:|||...|:.|||.|..    |:.| .:.|:.....|:::  .:.|:|.:
 Frog   187 TEGGKIFCILYAIFGIPLFGFLLAGIGDQLGT----IFGK-SIARVEKVFLKKQV--SQTKIRVI 244

  Fly   217 ARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTD 281
            :..|.:                                                     :.|...
 Frog   245 STILFI-----------------------------------------------------VAGCLV 256

  Fly   282 EITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRD-- 344
            .:|:|               |::|.:.|.|..|:..||.:::|::|||||.|.|.....:.|:  
 Frog   257 FVTIP---------------AVIFKQIEGWTELESLYFVVVTLTTIGFGDFVAGGNADISYREWY 306

  Fly   345 KVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKRGFK 387
            |..|.|     ::|:|:|..|...:::.:.    :|.|.:..|
 Frog   307 KPLVWF-----WILVGLAYFAAVLSMIGDW----LRVISKKTK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 31/71 (44%)
Ion_trans_2 292..377 CDD:285168 23/86 (27%)
kcnk10XP_002933240.1 Ion_trans_2 158..216 CDD:285168 30/57 (53%)
Ion_trans_2 254..333 CDD:285168 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.