DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk2

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_031758740.1 Gene:kcnk2 / 100495685 XenbaseID:XB-GENE-952207 Length:412 Species:Xenopus tropicalis


Alignment Length:398 Identity:98/398 - (24%)
Similarity:154/398 - (38%) Gaps:121/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRRSSFRRREKPAFERFKDHCRHFT--AFMFSNVG-IILLVTFYIIGGAFIFQSIEIFEYERLK 63
            |..|.||  ..|||....:|: |..|  ...:..|. :.|:|..|:|.||.:|:::         
 Frog    17 SKPRLSF--SAKPAVVSTRDN-REITMNVMKWKTVSTVFLVVVLYLIIGATVFKAL--------- 69

  Fly    64 SEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQL-----KGPD 123
             |:||         |...|...:..:|....:|........|.|:....|.:...:     ....
 Frog    70 -EQPH---------ESAQRTTIVIQKNNFILNHSCVNVTELDELIQQLMAAINAGIIPIGNTSHQ 124

  Fly   124 VEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWI 188
            ...|....:|.::.|||||||:|||:|.::.||:..|:||::|:|||...|:.:||.|...|.  
 Frog   125 NSHWDLGSSFFFAGTVITTIGFGNISPRTKGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFG-- 187

  Fly   189 YSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRS 253
                                     :.:||...|.:..|.                         
 Frog   188 -------------------------KGIARVEDMFEKWNV------------------------- 202

  Fly   254 SRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILW---GALLFGRWEDWNYLD 315
                                     |..:|.:..|| :|::.|.||:   .|::|...|||:.||
 Frog   203 -------------------------SQTKIRIISTV-IFILFGCILFVAIPAVIFQHIEDWHTLD 241

  Fly   316 GSYFCLISLSSIGFGDLVPGDRVIT-ADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNI 379
            ..||.:|:|::|||||.|.|...|. .|..|..|.|     ::|:|:|..|...:::.:.    :
 Frog   242 AFYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWF-----WILVGLAYFAAVLSMISDW----L 297

  Fly   380 RAIKRGFK 387
            |.|.|..|
 Frog   298 RVISRKTK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 26/59 (44%)
Ion_trans_2 292..377 CDD:285168 31/88 (35%)
kcnk2XP_031758740.1 Ion_trans_2 <128..182 CDD:400301 25/53 (47%)
Ion_trans_2 220..298 CDD:400301 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.