DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sand and kcnk6

DIOPT Version :9

Sequence 1:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001120420.1 Gene:kcnk6 / 100145504 XenbaseID:XB-GENE-958681 Length:308 Species:Xenopus tropicalis


Alignment Length:365 Identity:78/365 - (21%)
Similarity:130/365 - (35%) Gaps:150/365 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IILLVTFYIIG---GAFIFQSIEI-------FEYERLKS----EKPHRFIARNFSGECLSRIWEL 86
            :.|||..|:|.   ||.:...||.       .|..:|||    |.|           |:      
 Frog     7 LTLLVCAYVIYLLLGALVISVIESPYEASLRDELRQLKSVFLNESP-----------CV------ 54

  Fly    87 TAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPH 151
               |:|..:  |:..::    ::..:..|.......:..:|..:.:..::.|::||:|||..||.
 Frog    55 ---NVSSLE--AFLEKI----INANKYGVSVLHNASNDSKWDIASSMFFASTLVTTVGYGYTTPL 110

  Fly   152 SECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQL 216
            ::.||...|.||:||:|..:|.||:.                        .:|.::....|    
 Frog   111 TDSGKAFCIFYALIGVPFTMLVLSSF------------------------VQRLMVMFTHK---- 147

  Fly   217 ARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTD 281
                                                         .|.|.:.....:|::     
 Frog   148 ---------------------------------------------PIHYLQVQRGFDRKM----- 162

  Fly   282 EITVPVT------VCVFVMVGYILWGALLFGRWE-DWNYLDGSYFCLISLSSIGFGDLVPGDRVI 339
                 ||      :.:.|:|.:::..:.:|...| .|::||..|||.|||.:||.||.|||::  
 Frog   163 -----VTQLHFFFLLILVLVFFLIIPSAIFNTIETTWSFLDAFYFCFISLCTIGLGDYVPGEQ-- 220

  Fly   340 TADRD-------KVEVSFILCAIYLLLG---MAVIAMCFN 369
               .|       ||.|:|     ||.:|   |.:|...|:
 Frog   221 ---NDQWLRKLYKVSVAF-----YLFIGLMAMLLIVQTFH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 20/59 (34%)
Ion_trans_2 292..377 CDD:285168 31/89 (35%)
kcnk6NP_001120420.1 Ion_trans_2 72..141 CDD:369572 22/92 (24%)
Ion_trans_2 <193..251 CDD:369572 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.