DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut1 and PGLCT

DIOPT Version :9

Sequence 1:NP_523658.1 Gene:sut1 / 35774 FlyBaseID:FBgn0028563 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_568328.1 Gene:PGLCT / 831472 AraportID:AT5G16150 Length:546 Species:Arabidopsis thaliana


Alignment Length:492 Identity:139/492 - (28%)
Similarity:236/492 - (47%) Gaps:75/492 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GNLLLLVALATTFGGAVSTGYCIGVINAPSKLMKVWCNQTLHDTYGSNLSAGGLDLLWSCVVSVF 100
            |.:|..|.:|..  ||:..||.:||:|...:.:            ..:|......:|...:||..
plant   103 GTVLPFVGVACL--GAILFGYHLGVVNGALEYL------------AKDLGIAENTVLQGWIVSSL 153

  Fly   101 LVGGAIGSLGGAGAANKFGRKACFLICGALFTVGAVLFFFCRAASSVEMLVIGRFVVGLASGLVT 165
            |.|..:||..|...|:||||...|.:......:||   |.|..|.||:.:::||.:.|:..|:.:
plant   154 LAGATVGSFTGGALADKFGRTRTFQLDAIPLAIGA---FLCATAQSVQTMIVGRLLAGIGIGISS 215

  Fly   166 ATLPMYLSEVAPMALRGTLG----VFIAVGVTGGVVVGQVCSLANVFGTEDLWHYALTAYMFLIL 226
            |.:|:|:||::|..:||.||    :||.:|:...::.|  ..||    ...||      :..:..
plant   216 AIVPLYISEISPTEIRGALGSVNQLFICIGILAALIAG--LPLA----ANPLW------WRTMFG 268

  Fly   227 VCYLPSYLF-------PESPKFLYIVKGNRAAAKRELQRLRGKDAEELIAQEMAEMEAESNAKVQ 284
            |..:||.|.       ||||::| :.:|..:.|::.::.|.||       :.:.|:..:.:|..|
plant   269 VAVIPSVLLAIGMAFSPESPRWL-VQQGKVSEAEKAIKTLYGK-------ERVVELVRDLSASGQ 325

  Fly   285 TSSFCDV----LRDPRLTLPLIIVCCFHGGQQLSGINAIFYYSVSIFEKAGLSTVDAQWANLGAG 345
            .||..:.    |...|....:.:.......|||:||||:.|||.|:|..||:.:..|..|.:||.
plant   326 GSSEPEAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSVFRSAGIQSDVAASALVGAS 390

  Fly   346 CLNLAVSLLGPWLMAKCNRRTLMM--FSCALCSVFLFTIAFVLFYIDQVSWFAIAC---IVCIMG 405
              |:..:.:...||.|..|::|::  |.....|:.|.:::|        :|.|:|.   .:.::|
plant   391 --NVFGTAVASSLMDKMGRKSLLLTSFGGMALSMLLLSLSF--------TWKALAAYSGTLAVVG 445

  Fly   406 ---YIFFYQFGLGPIPYFIGAELF--EVAPRSVAMSMGSLASWTCNFIIGISFPLLQNAWG-AFV 464
               |:..:..|.||:|..:..|:|  .:..::||:|:|  ..|..||:||:.|..:...:| :.|
plant   446 TVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLG--MHWISNFVIGLYFLSVVTKFGISSV 508

  Fly   465 FLPFSITCVLLFLLTKFYLPETRGRDPSEVAPLVSKG 501
            :|.|:..|||..|.....:.||:||...|:...::.|
plant   509 YLGFAGVCVLAVLYIAGNVVETKGRSLEEIELALTSG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut1NP_523658.1 Sugar_tr 55..497 CDD:278511 132/467 (28%)
MFS 96..482 CDD:119392 120/411 (29%)
PGLCTNP_568328.1 MFS 109..524 CDD:119392 131/463 (28%)
Sugar_tr 111..539 CDD:278511 135/476 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326501at2759
OrthoFinder 1 1.000 - - FOG0000120
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.