DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut1 and Slc2a6

DIOPT Version :9

Sequence 1:NP_523658.1 Gene:sut1 / 35774 FlyBaseID:FBgn0028563 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:310 Identity:79/310 - (25%)
Similarity:131/310 - (42%) Gaps:40/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 WHYALTAYMFLILVCYLPSYLFPESPKFLYIVKGNRAAAKRELQRLRGKDAEELIAQEMAEMEAE 278
            |.:...|....:||..|.....|.||:||.    :::..:..||.|....|:..:..|..::  :
  Rat    10 WRWLAVAGEGPVLVMILLLSFMPNSPRFLL----SKSRDEEALQALIWLRADSEVHWEFEQI--Q 68

  Fly   279 SNAKVQTS--SFCDVLRDPRLTLPLIIVCCFHGGQQLSGINAIFYYSVSIFEKAGLSTVDAQWAN 341
            .|.:.|:|  |:.:.. :||:..|::|.......|||:||..|..|..:||:...:.....|.|.
  Rat    69 DNVRRQSSRVSWAEAW-EPRVYRPILITVLMRFLQQLTGITPILVYLQTIFDSTSVVLPSQQDAA 132

  Fly   342 LGAGCLNLAVSLLGPWLMAKCNRRTLMMFSCALCSVFLFTIAFVLFYIDQV-------------- 392
            : .|.:.|...|:....|....|:.|:..|.::..|...|:.   .|:..|              
  Rat   133 I-VGAVRLLSVLIAAVTMDLAGRKVLLYVSASIMFVANLTLG---LYVQLVPRTLTPNSTVEIVT 193

  Fly   393 ------------SWFAIACIVCIMGYIFFYQFGLGPIPYFIGAELFEVAPRSVAMSMGSLASWTC 445
                        ::..:..::..|.:|..|..|.|||.:.:.:|:..:..|.||..:..|.||..
  Rat   194 LGGTEQPPAAAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLT 258

  Fly   446 NFIIGISFPLLQNAWGAFV-FLPFSITCVLLFLLTKFYLPETRGRDPSEV 494
            .|::...|.|..||:|..| |..||..|:|..|.|...:||||||...::
  Rat   259 AFVLTKYFLLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSLEQI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut1NP_523658.1 Sugar_tr 55..497 CDD:278511 79/310 (25%)
MFS 96..482 CDD:119392 73/296 (25%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 51/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.