DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut1 and LOC103910009

DIOPT Version :9

Sequence 1:NP_523658.1 Gene:sut1 / 35774 FlyBaseID:FBgn0028563 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_009296669.1 Gene:LOC103910009 / 103910009 -ID:- Length:148 Species:Danio rerio


Alignment Length:106 Identity:35/106 - (33%)
Similarity:57/106 - (53%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 WFAIACIVCIMGYIFFYQFGLGP--IPYFIGAELFEVAPRSVAMSMGSLASWTCNFIIGISFPLL 456
            :.::||:|.|:.     .|.:||  :|:.:..|||:.:.|..|..:|...:|..||.:|..||.|
Zfish     3 YISVACVVGIIA-----GFCIGPAGVPFLMTGELFKQSHRPSAYIVGGSLNWISNFAVGFVFPFL 62

  Fly   457 QNAWGAFVFLPFSITCVLLFLLTKFYLPETRGRDPSEVAPL 497
            |.:.|||.:|.|...||.:.....|.:|||:.:...|::.|
Zfish    63 QMSAGAFCYLVFCGVCVGVAAYVFFIIPETKNKTFLEISEL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut1NP_523658.1 Sugar_tr 55..497 CDD:278511 34/104 (33%)
MFS 96..482 CDD:119392 29/89 (33%)
LOC103910009XP_009296669.1 Sugar_tr <1..104 CDD:278511 35/106 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291809at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.