DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12769 and MET31

DIOPT Version :9

Sequence 1:	NP_001286181.1	Gene:	CG12769 / 35770	FlyBaseID:	FBgn0033252	Length:	713	Species:	Drosophila melanogaster
Sequence 2:	NP_015287.1	Gene:	MET31 / 856069	SGDID:	S000005959	Length:	177	Species:	Saccharomyces cerevisiae

Alignment Length:	134	Identity:	41/134 - (30%)
Similarity:	60/134 - (44%)	Gaps:	28/134 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   102 LLHVVQCLAGQAAAAAAAAAASAR-LKSEDLQEPENMSLGHMEGGKGDGQTGNGSSSSASSSPAG 165
            |||.::    |::..:|...|... ||:   .|||||:.|.:.                  .|..
Yeast    38 LLHRIR----QSSPLSAVIPAPENVLKA---GEPENMARGLIR------------------IPET 77

  Fly   166 NSGGGGGGNSSSR--KVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHF 228
            .:...||.|.|..  :::.|..|.:|||..:::|||:..|:.|.|:.|..|.|.|.|||.|..|.
Yeast    78 QTKRTGGNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHS 142

  Fly   229 TTHT 232
            .|.|
Yeast   143 NTLT 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12769	NP_001286181.1	C2H2 Zn finger	183..203	CDD:275368	8/19 (42%)
		zf-H2C2_2	195..218	CDD:290200	9/22 (41%)
		C2H2 Zn finger	211..231	CDD:275368	9/19 (47%)
		C2H2 Zn finger	239..255	CDD:275368
		C2H2 Zn finger	662..689	CDD:275371
		C2H2 Zn finger	690..712	CDD:275371
MET31	NP_015287.1	COG5048	<75..>166	CDD:227381	27/72 (38%)
		C2H2 Zn finger	97..117	CDD:275368	8/19 (42%)
		C2H2 Zn finger	125..144	CDD:275368	9/18 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3390
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030