DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12769 and Zfp597

DIOPT Version :9

Sequence 1:	NP_001286181.1	Gene:	CG12769 / 35770	FlyBaseID:	FBgn0033252	Length:	713	Species:	Drosophila melanogaster
Sequence 2:	NP_001028331.2	Gene:	Zfp597 / 71063	MGIID:	1918313	Length:	419	Species:	Mus musculus

Alignment Length:	82	Identity:	32/82 - (39%)
Similarity:	43/82 - (52%)	Gaps:	1/82 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   179 KVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCPICN 243
            |.::|..|...||:..|:|.||..|||.|||:|..|...|.::.||:.|..:|.|...|.|.:|.
Mouse   181 KKYKCSTCEKTFSHRTNLRTHKRIHTGEKPYKCTECAASFRQQSHLSRHMNSHLKEKLYTCSVCG 245

  Fly   244 RGFQRQIAMRAHFQNEH 260
            |||.....:..| |..|
Mouse   246 RGFMWLPGLAEH-QKSH 261

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12769	NP_001286181.1	C2H2 Zn finger	183..203	CDD:275368	8/19 (42%)
		zf-H2C2_2	195..218	CDD:290200	12/22 (55%)
		C2H2 Zn finger	211..231	CDD:275368	6/19 (32%)
		C2H2 Zn finger	239..255	CDD:275368	5/15 (33%)
		C2H2 Zn finger	662..689	CDD:275371
		C2H2 Zn finger	690..712	CDD:275371
Zfp597	NP_001028331.2	KRAB	16..53	CDD:279668
		C2H2 Zn finger	157..177	CDD:275368
		zf-H2C2_2	169..194	CDD:290200	4/12 (33%)
		COG5048	183..>242	CDD:227381	23/58 (40%)
		zf-C2H2	183..205	CDD:278523	8/21 (38%)
		C2H2 Zn finger	185..205	CDD:275368	8/19 (42%)
		zf-H2C2_2	197..222	CDD:290200	13/24 (54%)
		C2H2 Zn finger	213..233	CDD:275368	6/19 (32%)
		C2H2 Zn finger	241..261	CDD:275368	7/20 (35%)
		C2H2 Zn finger	338..358	CDD:275368
		C2H2 Zn finger	366..386	CDD:275368
		zf-H2C2_2	378..402	CDD:290200
		C2H2 Zn finger	394..414	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167842435
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930