| Sequence 1: | NP_001286181.1 | Gene: | CG12769 / 35770 | FlyBaseID: | FBgn0033252 | Length: | 713 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_932152.1 | Gene: | Zbtb39 / 320080 | MGIID: | 2443316 | Length: | 712 | Species: | Mus musculus |
| Alignment Length: | 234 | Identity: | 59/234 - (25%) |
|---|---|---|---|
| Similarity: | 90/234 - (38%) | Gaps: | 56/234 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 LLHHNAMALRSLKDAASSASESELQEPRSPTPTPTNLSTGPHSPPMTFRCERC-DSFETSSRASL 101
Fly 102 LLHVVQ--CLAGQAAAAAAA----AAASARLKSEDLQEPENMSLGHMEGGKGDGQTGNGSSSSAS 160
Fly 161 SSPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLA 225
Fly 226 EHFTTHTKTLPYHCPICNRGFQRQIAMRAHFQNEHVGQH 264 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12769 | NP_001286181.1 | C2H2 Zn finger | 183..203 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 195..218 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 211..231 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 239..255 | CDD:275368 | 2/15 (13%) | ||
| C2H2 Zn finger | 662..689 | CDD:275371 | |||
| C2H2 Zn finger | 690..712 | CDD:275371 | |||
| Zbtb39 | NP_932152.1 | BTB | 20..119 | CDD:279045 | |
| BTB | 31..120 | CDD:197585 | |||
| C2H2 Zn finger | 345..366 | CDD:275368 | |||
| C2H2 Zn finger | 374..394 | CDD:275368 | |||
| C2H2 Zn finger | 402..420 | CDD:275368 | |||
| C2H2 Zn finger | 453..474 | CDD:275368 | |||
| C2H2 Zn finger | 482..502 | CDD:275368 | 1/2 (50%) | ||
| C2H2 Zn finger | 510..530 | CDD:275368 | 5/27 (19%) | ||
| C2H2 Zn finger | 540..560 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 607..627 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 619..642 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 635..655 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 663..683 | CDD:275368 | 5/24 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167842436 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||