DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and Zfp521

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_038952847.1 Gene:Zfp521 / 307579 RGDID:1307345 Length:1321 Species:Rattus norvegicus


Alignment Length:793 Identity:168/793 - (21%)
Similarity:257/793 - (32%) Gaps:219/793 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RSLKDAASSASESELQE------PRSPTPTPTNLSTGPHSPPMTFRCERC-DSFETSSRASLLLH 104
            ||||| .:...|.::::      .:.|...........||      |:.| ..||  |.:.:..|
  Rat    10 RSLKD-PNCKLEDKIEDGEAVDCKKRPDDGEELEEDAVHS------CDSCLQVFE--SLSDITEH 65

  Fly   105 VV-QC-------LAGQAAAAAAAAAASARLKSEDLQEP---ENMSLGHMEGGKG---DGQTGNGS 155
            .: ||       :......:..|::.|    |:|...|   |....|..|||.|   ..|..:.|
  Rat    66 KIHQCQLTDGVDVEDDPTCSWPASSPS----SKDQTSPSHGEGCDFGEEEGGPGLPYPCQFCDKS 126

  Fly   156 SSSASSSPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFR 220
            .|..|.......      :.|.:..|:|..|:..|.:..:..||...|||.|.|.|..|...|.|
  Rat   127 FSRLSYLKHHEQ------SHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCSECDAAFSR 185

  Fly   221 KDHLAEHFTTHTKTLPYHCPICNRGFQRQIAMRAHFQNEHVGQHDLVK----------------- 268
            .|||..|..|||...||.|.:|.|||....::..|.|     .|:..|                 
  Rat   186 SDHLKIHLKTHTSNKPYKCAVCRRGFLSSSSLHGHMQ-----VHERSKDGSQSGSRMEDWKMKDT 245

  Fly   269 -TCPLCSYRAGSMKSLRIHFFNRHGIDLDNPGPGGTSSLLLALESQASAAAAAAAASYVPPGLSP 332
             .|..|.......:.|:.|....|.                  |...:...||....|    ...
  Rat   246 QKCSQCEEGFDFPEDLQKHIAECHP------------------ECSPNEDRAALQCVY----CHE 288

  Fly   333 VPVQSQSQQQQQQQVAPPASDSGESMRSLENATPPMHFLTPHVEISTLGESGNTELFNLICVWRE 397
            :.|:..|.....:||     ..||...|....:.  .|||  ||          ||::.:    :
  Rat   289 LFVEETSLMNHIEQV-----HGGEKKNSCSICSE--SFLT--VE----------ELYSHM----D 330

  Fly   398 SALQGNNNNNNNNN----------CATNNNNNINGASNNCNSISNGNAESNGDKVKDRALIMQSP 452
            |..|..:.|::|:.          .:|..::|::..|:.....:....:|.|.|   ||....|.
  Rat   331 SHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRK---RAAQQTSD 392

  Fly   453 VELPMDCNTKATPITSS---------TTASSLSGGLKSHH-QHPHHHH----------------- 490
            :..|   ::|...:|.|         ::.:.|...||:.| ..|...|                 
  Rat   393 MTGP---SSKQAKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNE 454

  Fly   491 HHHHHHE------------------NHITPSISLIPIKQE----------PMSEDMDK---KDLM 524
            |....||                  |..:..::.:...||          |.::|.:.   ....
  Rat   455 HLKQVHEAQDPGLIVSAMPAIIYQCNFCSEVVNDLNTLQEHIRCSHGFANPAAKDSNAFFCPHCY 519

  Fly   525 NGSDPSSDTEQASNNNNSSSNNNRITSLIKVSPLKSLLREDLKRRICAKA---NNRITRNATPLE 586
            .|....|..|:.....:...:.:|..|.:..:| |..:.|......|..:   |:.:..|....|
  Rat   520 MGFLTDSSLEEHIRQVHCDLSGSRFGSPVLGTP-KEPVVEVYSCSYCTNSPIFNSVLKLNKHIKE 583

  Fly   587 SNNNNSVLSNSLSNG--SGRGSP---------------GVNGGSGGGGGGGPPTPATPSATN--G 632
            ::.|..:..|.:.||  |...||               .|        ||||...|.....|  |
  Rat   584 NHKNIPLALNYIHNGKKSRALSPLSPVAIEQTSLKMMQTV--------GGGPARAAGEYICNQCG 640

  Fly   633 ASSTPICNGTITSTGQDGDLLINRKLILTCHFCGIEFPDETLYFLHKGCH--CESNPWRCNICGE 695
            |..|.: :...|......|.::.:   |||..|..|||::.....|...|  ..|..:.|..|.:
  Rat   641 AKYTSL-DSFQTHLKTHLDTVLPK---LTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCDK 701

  Fly   696 QLNNVYEFNSHLL 708
            |..:|.:...|||
  Rat   702 QFTSVDDLQKHLL 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
zf-H2C2_2 195..218 CDD:290200 9/22 (41%)
C2H2 Zn finger 211..231 CDD:275368 8/19 (42%)
C2H2 Zn finger 239..255 CDD:275368 5/15 (33%)
C2H2 Zn finger 662..689 CDD:275371 8/28 (29%)
C2H2 Zn finger 690..712 CDD:275371 7/19 (37%)
Zfp521XP_038952847.1 COG5048 <84..236 CDD:227381 49/166 (30%)
C2H2 Zn finger 120..140 CDD:275368 4/25 (16%)
C2H2 Zn finger 148..168 CDD:275368 5/19 (26%)
C2H2 Zn finger 176..196 CDD:275368 8/19 (42%)
C2H2 Zn finger 204..224 CDD:275368 7/24 (29%)
C2H2 Zn finger 312..332 CDD:275368 7/37 (19%)
C2H2 Zn finger 407..428 CDD:275368 3/20 (15%)
C2H2 Zn finger 439..460 CDD:275368 1/20 (5%)
C2H2 Zn finger 479..498 CDD:275368 3/18 (17%)
C2H2 Zn finger 636..656 CDD:275368 5/20 (25%)
C2H2 Zn finger 666..686 CDD:275368 6/19 (32%)
C2H2 Zn finger 696..713 CDD:275368 4/16 (25%)
C2H2 Zn finger 724..745 CDD:275368
C2H2 Zn finger 754..774 CDD:275368
COG5236 785..>964 CDD:227561
C2H2 Zn finger 785..805 CDD:275368
C2H2 Zn finger 811..829 CDD:275368
C2H2 Zn finger 888..909 CDD:275368
C2H2 Zn finger 932..952 CDD:275368
C2H2 Zn finger 961..981 CDD:275368
C2H2 Zn finger 1228..1248 CDD:275368
C2H2 Zn finger 1259..1280 CDD:275368
C2H2 Zn finger 1289..1305 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.