| Sequence 1: | NP_001286181.1 | Gene: | CG12769 / 35770 | FlyBaseID: | FBgn0033252 | Length: | 713 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001124009.1 | Gene: | Zbtb39 / 299510 | RGDID: | 1306532 | Length: | 711 | Species: | Rattus norvegicus |
| Alignment Length: | 233 | Identity: | 59/233 - (25%) |
|---|---|---|---|
| Similarity: | 89/233 - (38%) | Gaps: | 56/233 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 LHHNAMALRSLKDAASSASESELQEPRSPTPTPTNLSTGPHSPPMTFRCERC-DSFETSSRASLL 102
Fly 103 LHVVQ--CLAG----QAAAAAAAAAASARLKSEDLQEPENMSLGHMEGGKGDGQTGNGSSSSASS 161
Fly 162 SPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAE 226
Fly 227 HFTTHTKTLPYHCPICNRGFQRQIAMRAHFQNEHVGQH 264 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12769 | NP_001286181.1 | C2H2 Zn finger | 183..203 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 195..218 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 211..231 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 239..255 | CDD:275368 | 2/15 (13%) | ||
| C2H2 Zn finger | 662..689 | CDD:275371 | |||
| C2H2 Zn finger | 690..712 | CDD:275371 | |||
| Zbtb39 | NP_001124009.1 | BTB_POZ_ZBTB39 | 4..126 | CDD:349533 | |
| C2H2 Zn finger | 344..365 | CDD:275368 | |||
| C2H2 Zn finger | 373..393 | CDD:275368 | |||
| C2H2 Zn finger | 401..419 | CDD:275368 | |||
| C2H2 Zn finger | 452..473 | CDD:275368 | |||
| C2H2 Zn finger | 481..501 | CDD:275368 | 1/1 (100%) | ||
| C2H2 Zn finger | 509..529 | CDD:275368 | 5/27 (19%) | ||
| C2H2 Zn finger | 539..559 | CDD:275368 | 8/21 (38%) | ||
| zf-C2H2 | 604..626 | CDD:395048 | 5/21 (24%) | ||
| C2H2 Zn finger | 606..626 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 618..642 | CDD:404364 | 11/23 (48%) | ||
| C1 | 620..>667 | CDD:412127 | 19/51 (37%) | ||
| C2H2 Zn finger | 634..654 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 662..682 | CDD:275368 | 5/24 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166345878 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||