DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12769 and Zfp597

DIOPT Version :9

Sequence 1:	NP_001286181.1	Gene:	CG12769 / 35770	FlyBaseID:	FBgn0033252	Length:	713	Species:	Drosophila melanogaster
Sequence 2:	NP_714954.2	Gene:	Zfp597 / 266774	RGDID:	628674	Length:	419	Species:	Rattus norvegicus

Alignment Length:	113	Identity:	38/113 - (33%)
Similarity:	52/113 - (46%)	Gaps:	9/113 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   174 NSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYH 238
            :|..|| ::|..|...||:..|::.|:..|||.|||:|..|...|.::.||..|..:|.|..||.
  Rat   176 HSRERK-YKCGTCEKTFSHRTNLKTHRRIHTGEKPYKCTECAASFRQQSHLTRHMNSHLKEKPYT 239

  Fly   239 CPICNRGFQRQIAMRAHFQNEHV-------GQHDLVKTCPLCSYRAGS 279
            |.:|.|||.....:..| |..|.       ..||...:..|...|..|
  Rat   240 CSVCGRGFMWLPGLAEH-QKSHTDTESYESADHDQETSLALPEERGSS 286

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12769	NP_001286181.1	C2H2 Zn finger	183..203	CDD:275368	6/19 (32%)
		zf-H2C2_2	195..218	CDD:290200	10/22 (45%)
		C2H2 Zn finger	211..231	CDD:275368	6/19 (32%)
		C2H2 Zn finger	239..255	CDD:275368	5/15 (33%)
		C2H2 Zn finger	662..689	CDD:275371
		C2H2 Zn finger	690..712	CDD:275371
Zfp597	NP_714954.2	KRAB	16..50	CDD:279668
		C2H2 Zn finger	156..176	CDD:275368	38/113 (34%)
		zf-C2H2	182..204	CDD:278523	6/21 (29%)
		C2H2 Zn finger	184..204	CDD:275368	6/19 (32%)
		zf-H2C2_2	196..221	CDD:290200	11/24 (46%)
		C2H2 Zn finger	212..232	CDD:275368	6/19 (32%)
		zf-H2C2_2	224..247	CDD:290200	10/22 (45%)
		C2H2 Zn finger	240..260	CDD:275368	7/20 (35%)
		C2H2 Zn finger	338..358	CDD:275368
		C2H2 Zn finger	366..386	CDD:275368
		zf-H2C2_2	378..401	CDD:290200
		zf-C2H2	392..414	CDD:278523
		C2H2 Zn finger	394..414	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166345877
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930