DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and Zfp668

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001349118.1 Gene:Zfp668 / 244219 MGIID:2442943 Length:619 Species:Mus musculus


Alignment Length:340 Identity:90/340 - (26%)
Similarity:112/340 - (32%) Gaps:89/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HSPPMTFRCERC-DSFETSSRASLLLHVVQCLAGQAAAAAAAAAASARLKSEDLQEPENMSLGHM 142
            |:....|.|..| .||..||  ||..|       |...||              |:|....    
Mouse   218 HTGERPFLCSECGKSFSRSS--SLTCH-------QRIHAA--------------QKPYRCP---- 255

  Fly   143 EGGKGDGQTGNGSSSSASSSPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVK 207
            ..|||..|.     ||..|....:||         .|.|.|..|...||:.::.|||:..|.|||
Mouse   256 ACGKGFTQL-----SSYQSHERTHSG---------EKPFLCPRCGRMFSDPSSFRRHQRAHEGVK 306

  Fly   208 PYECRVCQKRFFRKDHLAEHFTTHT-----------KTL-----------------PYHCPICNR 244
            ||.|..|.|.|.:...||.|...||           ||.                 |:.|..|.|
Mouse   307 PYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHALVHSGQRPFRCEECGR 371

  Fly   245 GFQRQIAMRAHFQNEHVGQHDLVKTCPLCSYRAGSMKSLRIHFFNRHGIDLDNPGPGGTSSLLLA 309
            .|..:.::..| ...|.|:...  .|..|......:.|||.|.......:.....|.....|.||
Mouse   372 AFAERASLTKH-SRMHSGERPF--HCNACGKSFVVLSSLRKHERTHRSNETTGAAPQQELVLGLA 433

  Fly   310 LE----SQASAA-AAAAAASYVPPGLSPVPVQSQSQQQQQQQVAPPASDSGESMRSLENATPPMH 369
            |.    .:.||| .|.|.....|.||..:|.:|......|.||.....:..|...:.....|   
Mouse   434 LPVGVVGEGSAAPVAGAGVGDAPAGLLGLPPESGGVVATQWQVVGMTVEHVECQDAGVGEAP--- 495

  Fly   370 FLTPHVEISTLGESG 384
                    ||||::|
Mouse   496 --------STLGDAG 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
zf-H2C2_2 195..218 CDD:290200 12/22 (55%)
C2H2 Zn finger 211..231 CDD:275368 7/19 (37%)
C2H2 Zn finger 239..255 CDD:275368 4/15 (27%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
Zfp668NP_001349118.1 C2H2 Zn finger 24..44 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..74
COG5048 65..419 CDD:227381 65/244 (27%)
C2H2 Zn finger 86..106 CDD:275368
C2H2 Zn finger 114..134 CDD:275368
C2H2 Zn finger 142..162 CDD:275368
C2H2 Zn finger 170..190 CDD:275368
C2H2 Zn finger 198..218 CDD:275368 90/340 (26%)
C2H2 Zn finger 226..246 CDD:275368 10/28 (36%)
COG5048 248..598 CDD:227381 77/301 (26%)
C2H2 Zn finger 254..274 CDD:275368 7/28 (25%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..330 CDD:275368 7/19 (37%)
C2H2 Zn finger 338..358 CDD:275368 2/19 (11%)
C2H2 Zn finger 366..386 CDD:275368 5/20 (25%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..513 6/23 (26%)
C2H2 Zn finger 518..538 CDD:275368
C2H2 Zn finger 546..566 CDD:275368
C2H2 Zn finger 574..594 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.