DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and Zfp462

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_006537978.1 Gene:Zfp462 / 242466 MGIID:107690 Length:2556 Species:Mus musculus


Alignment Length:402 Identity:83/402 - (20%)
Similarity:124/402 - (30%) Gaps:135/402 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSTGPHSPPMTFRCERCDSFETSSRASLLLHV-----------------VQCLAGQAAAAAAAA- 120
            |.:||.....||:|:.||| :..|.|.|..|:                 .|.|:.|..|..|.| 
Mouse  1870 LGSGPRFQNSTFQCKHCDS-KLQSIAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFAD 1933

  Fly   121 -----------------------------------------------------AASARLKSEDLQ 132
                                                                 |.||.:|.| .:
Mouse  1934 FKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHVQYGSVPAVSAAVKQE-AE 1997

  Fly   133 EPENMSLGHMEGGKGDGQTGNGSSSSASSSPAGNSGGG--------------GGGNSSSRKVFEC 183
            :|.::.|..:|..:           .||.:..|...||              ||        :.|
Mouse  1998 DPSHLFLDGLEAAR-----------DASGTLVGRVDGGHCLLDAMLEDETRPGG--------YHC 2043

  Fly   184 DVCNMKFSNGANMRRHKMRH------TGVKPYECRVCQKRFFRKDHLAEHFTT-HTKTLPYHCPI 241
            ..|:....:...:|.|:..|      |....|.|:.|......:.:|..|..| |....|:.|.:
Mouse  2044 SQCDRVLMSMQGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHNLDRHMQTHHGHHKPFRCKL 2108

  Fly   242 CNRGFQRQIAMRAHFQNEHVGQHDLVKTCPLCSYRAGSMKSLRIHFFNRHGIDLDNPGPGGTSSL 306
            |:........::.|....|.|:|  ...|..||:...::..|:.|....||..|..|.|...|  
Mouse  2109 CSFKSSYNSRLKTHILKAHAGEH--AYKCSWCSFSTMTISQLKEHSLKVHGKALTLPRPRIVS-- 2169

  Fly   307 LLALESQASAAAAAAA--------ASYVPPGLSPVPVQSQSQQQQQQQVA------PPASDSGES 357
            ||:..:..|:..|..|        :||    ..|..||.|....|...:|      .|...||.:
Mouse  2170 LLSSHAHPSSQKATPAEEVEDSNDSSY----SEPPDVQQQLNHYQSAALARNKSRVSPVPPSGTA 2230

  Fly   358 MRSLENATPPMH 369
            ..:.:.|...:|
Mouse  2231 AGTEQKAEAVLH 2242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 4/19 (21%)
zf-H2C2_2 195..218 CDD:290200 7/28 (25%)
C2H2 Zn finger 211..231 CDD:275368 5/20 (25%)
C2H2 Zn finger 239..255 CDD:275368 2/15 (13%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
Zfp462XP_006537978.1 C2H2 Zn finger 2043..2063 CDD:275368 4/19 (21%)
zf-H2C2_5 2075..2099 CDD:404746 6/23 (26%)
C2H2 Zn finger 2077..2097 CDD:275368 4/19 (21%)
C2H2 Zn finger 2106..2127 CDD:275368 3/20 (15%)
C2H2 Zn finger 2135..2156 CDD:275368 5/20 (25%)
C2H2 Zn finger 2306..2326 CDD:275368
C2H2 Zn finger 2352..2372 CDD:275368
C2H2 Zn finger 2380..2401 CDD:275368
C2H2 Zn finger 2466..2486 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.