DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and F26F4.8

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001379726.1 Gene:F26F4.8 / 184991 WormBaseID:WBGene00005011 Length:302 Species:Caenorhabditis elegans


Alignment Length:122 Identity:33/122 - (27%)
Similarity:50/122 - (40%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 NSSSRKV-FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTK--TL 235
            |::|..| .:|..|:..|::..::|.|...|.. |..||..|.|.|.|.|.|..|...|..  ||
 Worm    16 NTTSPDVKVKCKQCDRFFTSERSLRCHIKVHND-KLLECYFCDKMFNRTDTLFFHALDHISKGTL 79

  Fly   236 PYHCPICNRGFQRQIAMRAHFQNEHVGQHDLVKTCPLCSYRAGSMKSLRIHFFNRHG 292
            |.....|::..:..:....|....|.....:...|..||..:.|.:.:..|...:||
 Worm    80 PCRAEGCDQLVETMLEGENHANTAHHVNGTVSIKCKDCSEVSVSFRKMLFHHTFKHG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
zf-H2C2_2 195..218 CDD:290200 8/22 (36%)
C2H2 Zn finger 211..231 CDD:275368 8/19 (42%)
C2H2 Zn finger 239..255 CDD:275368 1/15 (7%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
F26F4.8NP_001379726.1 C2H2 Zn finger 26..46 CDD:275368 5/19 (26%)
C2H2 Zn finger 53..73 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.